(data stored in SCRATCH zone)

EMBL: CP002293.PE93

CP002293.PE93        Location/Qualifiers
FT   CDS             116729..117379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0093"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: gwc:GWCH70_0094 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-H
FT                   factor; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72949"
FT                   /db_xref="GOA:A0A0F6BHP8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP8"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ADP72949.1"
FT                   /translation="MGECFKEKTYKSYKHLEDEQLVELVHQGDGDALDFLIHKYQNFVR
FT                   AKARSYFLVGADREDIIQEGMIGLYKAVRDFKGDKLSSFKAFAELCITRQMITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDDESDRTLMDVISGTKATDPEELIVNREEVDDIEVKMTELL
FT                   SDLERKVLALYLDGRSYQEISEELNRHVKSIDNALQRVKRKLEKYLECREISL"
     MGECFKEKTY KSYKHLEDEQ LVELVHQGDG DALDFLIHKY QNFVRAKARS YFLVGADRED        60
     IIQEGMIGLY KAVRDFKGDK LSSFKAFAEL CITRQMITAI KTATRQKHIP LNSYVSLDKP       120
     IYDDESDRTL MDVISGTKAT DPEELIVNRE EVDDIEVKMT ELLSDLERKV LALYLDGRSY       180
     QEISEELNRH VKSIDNALQR VKRKLEKYLE CREISL                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page