(data stored in ACNUC7421 zone)

EMBL: CP002293.PE95

CP002293.PE95        Location/Qualifiers
FT   CDS             117663..117845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0095"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="KEGG: gwc:GWCH70_0096 preprotein translocase, SecE
FT                   subunit; TIGRFAM: preprotein translocase, SecE subunit;
FT                   PFAM: protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72951"
FT                   /db_xref="GOA:A0A0F6BHQ0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ0"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADP72951.1"
FT                   /translation="MQRMINFFKDVAREMKKVSWPSRKELVNYTVIVLATVAFFTVFFA
FT                   VVDLGISELIRLVFE"
     MQRMINFFKD VAREMKKVSW PSRKELVNYT VIVLATVAFF TVFFAVVDLG ISELIRLVFE        60
//

If you have problems or comments...

PBIL Back to PBIL home page