(data stored in SCRATCH zone)

EMBL: CP002293.PE96

CP002293.PE96        Location/Qualifiers
FT   CDS             117975..118508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0096"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain-containing protein; KOW
FT                   domain protein; KEGG: gwc:GWCH70_0097 NusG antitermination
FT                   factor; SMART: NGN domain-containing protein; KOW domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72952"
FT                   /db_xref="GOA:A0A0F6BHQ1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ1"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADP72952.1"
FT                   /translation="MEKNWYVIHTYSGYENKVKANLEKRVESMGMQDKIFRIVVPEETE
FT                   TETKSGKKKAAKRKVFPGYVLVEMVMTDDSWYVVRNTPGVTGFVGSSGAGSKPTPLLEE
FT                   EVEMILKRMGMQLAELDVDYELKETVRVKEGPFANFTGTIEEIDVDKRKVKVLVNMFGR
FT                   ETPVEFEFSQIEKI"
     MEKNWYVIHT YSGYENKVKA NLEKRVESMG MQDKIFRIVV PEETETETKS GKKKAAKRKV        60
     FPGYVLVEMV MTDDSWYVVR NTPGVTGFVG SSGAGSKPTP LLEEEVEMIL KRMGMQLAEL       120
     DVDYELKETV RVKEGPFANF TGTIEEIDVD KRKVKVLVNM FGRETPVEFE FSQIEKI          177
//

If you have problems or comments...

PBIL Back to PBIL home page