(data stored in ACNUC7421 zone)

EMBL: CP002293.PE97

CP002293.PE97        Location/Qualifiers
FT   CDS             118754..119179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0097"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; KEGG: ribosomal protein L11; SMART:
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72953"
FT                   /db_xref="GOA:A0A0F6BHQ2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ2"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADP72953.1"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNAR
FT                   TADQAGLIIPVEITVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDK
FT                   VREIAELKMPDLNAASIEAAMRMVEGTARSMGIVIED"
     MAKKVVKVVK LQIPAGKANP APPVGPALGQ AGVNIMAFCK EFNARTADQA GLIIPVEITV        60
     YEDRSFTFIT KTPPAAVLLK KAAGIESGSG EPNRNKVATI KRDKVREIAE LKMPDLNAAS       120
     IEAAMRMVEG TARSMGIVIE D                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page