(data stored in ACNUC7421 zone)

EMBL: CP002293.PE98

CP002293.PE98        Location/Qualifiers
FT   CDS             119287..119988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0098"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: gwc:GWCH70_0099 ribosomal protein L1; TIGRFAM:
FT                   ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72954"
FT                   /db_xref="GOA:A0A0F6BHQ3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ3"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADP72954.1"
FT                   /translation="MPRRGKKYLEALKLVDRSKAYPVAEAIELVKKTNIAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADYVGDTEYINKI
FT                   QEGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPNPKTGTVTFDVAKAVQEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFDNEKLVENFTTIYEAILKAKPAAAKGTYVKNVTVTSTMGPGI
FT                   KVDPSTVAVAQ"
     MPRRGKKYLE ALKLVDRSKA YPVAEAIELV KKTNIAKFDA TVEVAFRLGV DPKKADQQIR        60
     GAVVLPHGTG KVQRVLVFAK GEKAKEAEAA GADYVGDTEY INKIQEGWFD FDVVVATPDM       120
     MGEVGKLGRI LGPKGLMPNP KTGTVTFDVA KAVQEIKAGK VEYRVDKAGN IHVPIGKVSF       180
     DNEKLVENFT TIYEAILKAK PAAAKGTYVK NVTVTSTMGP GIKVDPSTVA VAQ              233
//

If you have problems or comments...

PBIL Back to PBIL home page