(data stored in ACNUC7421 zone)

EMBL: CP002293.PE99

CP002293.PE99        Location/Qualifiers
FT   CDS             120238..120738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0099"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: gwc:GWCH70_0100
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72955"
FT                   /db_xref="GOA:A0A0F6BHQ4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ4"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADP72955.1"
FT                   /translation="MGSAIELKKQIVAEIADKFRASKSTVIVDYRGLNVAEITELRKRL
FT                   REAGVEFKVYKNTLTRRALAEVGLEGLNDVFTGPNAIAFSNEDVVAPAKILSEFAKEHE
FT                   ALEIKAGVIEGNIATIEEINALAKLPSREGLLSMLLSVLQAPIRNFALAAKAVADQKEE
FT                   QSA"
     MGSAIELKKQ IVAEIADKFR ASKSTVIVDY RGLNVAEITE LRKRLREAGV EFKVYKNTLT        60
     RRALAEVGLE GLNDVFTGPN AIAFSNEDVV APAKILSEFA KEHEALEIKA GVIEGNIATI       120
     EEINALAKLP SREGLLSMLL SVLQAPIRNF ALAAKAVADQ KEEQSA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page