(data stored in ACNUC7421 zone)

EMBL: CP002299.PE10

CP002299.PE10        Location/Qualifiers
FT   CDS             14660..15937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78098"
FT                   /db_xref="GOA:E3J260"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E3J260"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0023"
FT                   /protein_id="ADP78098.1"
FT                   /translation="MASTDAFAAQPSAAPHEATVRPTVPTRRGVLAPDRLADLHPLARP
FT                   PETSPLLTAAEVRATADSIAAMQDPDGAIPWFPGGHTDAWDHLECAMALELGGRDDAAQ
FT                   RAWDWLLRNQRDDGSWATSYIGGGVRENFADSNQCAYVATAVWHHWRRTGDAAFVAGMW
FT                   PVVRAALDFVIDMQAPSGVIWWARDAEGKDYPLAMLTGCSSTLHSLRCGLGLAALVGDA
FT                   RPDWELAAGRLAHALRAHPEYFAPTSRWSMDWYYPVIGGALRGAEGLERLRGRWAEFVI
FT                   EGLGIRCVSDEPWVTGAETCELAIALHLVGETAAARTLVRDMQHLRHHDGAYWTGWQFV
FT                   GGAHWPDERSTWTAAAVILAVDTLSGGVTEAVFRGDGLPEPLPTLAPDGEELDDVEALD
FT                   RLGCDCDPAPVIGAWSNDELAGRLAS"
     MASTDAFAAQ PSAAPHEATV RPTVPTRRGV LAPDRLADLH PLARPPETSP LLTAAEVRAT        60
     ADSIAAMQDP DGAIPWFPGG HTDAWDHLEC AMALELGGRD DAAQRAWDWL LRNQRDDGSW       120
     ATSYIGGGVR ENFADSNQCA YVATAVWHHW RRTGDAAFVA GMWPVVRAAL DFVIDMQAPS       180
     GVIWWARDAE GKDYPLAMLT GCSSTLHSLR CGLGLAALVG DARPDWELAA GRLAHALRAH       240
     PEYFAPTSRW SMDWYYPVIG GALRGAEGLE RLRGRWAEFV IEGLGIRCVS DEPWVTGAET       300
     CELAIALHLV GETAAARTLV RDMQHLRHHD GAYWTGWQFV GGAHWPDERS TWTAAAVILA       360
     VDTLSGGVTE AVFRGDGLPE PLPTLAPDGE ELDDVEALDR LGCDCDPAPV IGAWSNDELA       420
     GRLAS                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page