(data stored in ACNUC7421 zone)

EMBL: CP002299.PE101

CP002299.PE101       Location/Qualifiers
FT   CDS             119652..121715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0101"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: fal:FRAAL6732 hypothetical protein; manually
FT                   curated; PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78189"
FT                   /db_xref="GOA:E3J3I7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP78189.1"
FT                   /translation="MAEPGAATESPTGTVGRVRASLGTGVGRIRATTRRDGADRSGLAA
FT                   LLDLSVINAAGDALVTVALAGSLFFSVPTGQARSKVALYLLITMVPFVLLAPVIGPLLD
FT                   RVAHGRRTALAALCLGRCLLAWQLAAQLSGLQVYPLALGLLMLSRAFGIARSAVIPRVA
FT                   PPELTLVKVNSRMSMVNIVASSVIAPIGLGIAHIPYVGYAWVLRLCALLYLVGVLLAIN
FT                   LPKRVDSNAGERALRDIVAGATGPRAAAAPGQPVAAGLQYQAVAGTVVDAESRGRRLAG
FT                   KHARWHALVRAVLGASPVALRSTLVLRAIVGFLTFFLAFLLRTEGGTNLWLGALAASAA
FT                   VGSGLGVVIGGRLGRRRPERILTLALLLTTVGCLLAAIDYAKFPALFAALLAMLAAAMA
FT                   KLALDAIIQRDTADDVRNSAFARSETVLQLGWVAGGALGLIEMPGQLGFLIAGLVPAAA
FT                   LFPQAREIRRARGAADRAERLRASGGDPAAWPGAATGTWVQPDGTTVLPVMMPAPDRPF
FT                   RPVAGQAPDDATRPWRAAPEPPMPAGGPVVPGYPSVSPPPAAPPTLWYPGSGEYQGSGE
FT                   DQANGGYPGSGGYAGSGEYPGNGGYPGPGGYPEVGAYPAPGDQTAGQPVGPWVRAPGPV
FT                   DETTTRPARRRPWGRARRADSEADPDTTLPLGSDRRFPDVPPPRDTPNQSAD"
     MAEPGAATES PTGTVGRVRA SLGTGVGRIR ATTRRDGADR SGLAALLDLS VINAAGDALV        60
     TVALAGSLFF SVPTGQARSK VALYLLITMV PFVLLAPVIG PLLDRVAHGR RTALAALCLG       120
     RCLLAWQLAA QLSGLQVYPL ALGLLMLSRA FGIARSAVIP RVAPPELTLV KVNSRMSMVN       180
     IVASSVIAPI GLGIAHIPYV GYAWVLRLCA LLYLVGVLLA INLPKRVDSN AGERALRDIV       240
     AGATGPRAAA APGQPVAAGL QYQAVAGTVV DAESRGRRLA GKHARWHALV RAVLGASPVA       300
     LRSTLVLRAI VGFLTFFLAF LLRTEGGTNL WLGALAASAA VGSGLGVVIG GRLGRRRPER       360
     ILTLALLLTT VGCLLAAIDY AKFPALFAAL LAMLAAAMAK LALDAIIQRD TADDVRNSAF       420
     ARSETVLQLG WVAGGALGLI EMPGQLGFLI AGLVPAAALF PQAREIRRAR GAADRAERLR       480
     ASGGDPAAWP GAATGTWVQP DGTTVLPVMM PAPDRPFRPV AGQAPDDATR PWRAAPEPPM       540
     PAGGPVVPGY PSVSPPPAAP PTLWYPGSGE YQGSGEDQAN GGYPGSGGYA GSGEYPGNGG       600
     YPGPGGYPEV GAYPAPGDQT AGQPVGPWVR APGPVDETTT RPARRRPWGR ARRADSEADP       660
     DTTLPLGSDR RFPDVPPPRD TPNQSAD                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page