(data stored in ACNUC7421 zone)

EMBL: CP002299.PE102

CP002299.PE102       Location/Qualifiers
FT   CDS             complement(121885..122877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0102"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: fal:FRAAL6729 putative
FT                   amino acid ABC transporter amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78190"
FT                   /db_xref="GOA:E3J3I8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I8"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADP78190.1"
FT                   /translation="MADTASVYRHSRGQRNPGRAVGIAALLTLALGAAACGGSGGSAKG
FT                   GGGTNGVPRGHLTVADAGFTESKILADIYAQLLTKAGYGVDRTSIASTEIAESSLESGQ
FT                   IDVMPQYVATYADLLSSLVNGKDTPPVSSSDLTASLAALRRFAAGKGLTALNPANAVDQ
FT                   NAFAVTKDFASAHQLRTLSDLGASGVAVTVAATTECPTRPFCQPGLERTYGIKIAGLVQ
FT                   TGFDTAQTKAAVRDGLAQLGLVATTDATVDDYGLVILTDDKKLQNADNLVPIVNTRSLT
FT                   PEISAALNVLAPVLTTADLADLDRRVDSDGEASAAVATEYLTRKRLLPA"
     MADTASVYRH SRGQRNPGRA VGIAALLTLA LGAAACGGSG GSAKGGGGTN GVPRGHLTVA        60
     DAGFTESKIL ADIYAQLLTK AGYGVDRTSI ASTEIAESSL ESGQIDVMPQ YVATYADLLS       120
     SLVNGKDTPP VSSSDLTASL AALRRFAAGK GLTALNPANA VDQNAFAVTK DFASAHQLRT       180
     LSDLGASGVA VTVAATTECP TRPFCQPGLE RTYGIKIAGL VQTGFDTAQT KAAVRDGLAQ       240
     LGLVATTDAT VDDYGLVILT DDKKLQNADN LVPIVNTRSL TPEISAALNV LAPVLTTADL       300
     ADLDRRVDSD GEASAAVATE YLTRKRLLPA                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page