(data stored in ACNUC7421 zone)

EMBL: CP002299.PE103

CP002299.PE103       Location/Qualifiers
FT   CDS             complement(123093..124022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0103"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: sma:SAV_2178 ABC
FT                   transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78191"
FT                   /db_xref="GOA:E3J3I9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I9"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADP78191.1"
FT                   /translation="MYRKTTSAFVALALPVVLTLAACGSSGSSGSSASPSAGASAAADA
FT                   GSLTIGSADFTESALLADIYADALAAKGVKITKKLNIGERSVYVKALQDGSIDFIPEYN
FT                   GSILAYLDPKATAKSTAEVTAALPAALGSKLTALTPATAQDSDTITVTKATADKYHLTS
FT                   IADLTSVADKLTFGAPAAFQTRPDGIPALKSVYGVTFGNFTALSASGTVTVTSLKNGTI
FT                   DGADIFSTDPSFASEGFVALADPKNMFAAQNVTPVVATAKVTPTIKDTVNAVSAKLTTA
FT                   ILADLDAKVGTGDPDAVAKQWLTSVGLA"
     MYRKTTSAFV ALALPVVLTL AACGSSGSSG SSASPSAGAS AAADAGSLTI GSADFTESAL        60
     LADIYADALA AKGVKITKKL NIGERSVYVK ALQDGSIDFI PEYNGSILAY LDPKATAKST       120
     AEVTAALPAA LGSKLTALTP ATAQDSDTIT VTKATADKYH LTSIADLTSV ADKLTFGAPA       180
     AFQTRPDGIP ALKSVYGVTF GNFTALSASG TVTVTSLKNG TIDGADIFST DPSFASEGFV       240
     ALADPKNMFA AQNVTPVVAT AKVTPTIKDT VNAVSAKLTT AILADLDAKV GTGDPDAVAK       300
     QWLTSVGLA                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page