(data stored in ACNUC7421 zone)

EMBL: CP002299.PE106

CP002299.PE106       Location/Qualifiers
FT   CDS             complement(125518..126669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0106"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nml:Namu_1406 glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78194"
FT                   /db_xref="GOA:E3J3J2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78194.1"
FT                   /translation="MIRFESVTKRYPDGTVAVDALDLVAETGKITVLVGPSGCGKTTSL
FT                   RMINRMIEPTSGRIWLDDRDTATIRSDQLRRGIGYVIQHAGLFPHRTVLDNITTVPRLL
FT                   GRGRREARGQALELLERVGLPAAFAGRYPAQLSGGQQQRVGVARALAADPPVMLMDEPF
FT                   SAVDPVVRGQLQDEFLRLQHELRKTIVLVTHDIDEAIRLGDQVAVLRVGGRLAQLAPPG
FT                   ELLASPADSFVAGFVGRDRGYRALGFTHAGELPLLDEPTVTVGAPLKSAPDLARDGWVL
FT                   ALDEERRPLGWLATSATAEVGAATATGEGTVDADKLNLGGTLTPEAGTLREALDAALSS
FT                   PSGRGVVVHADGTFAGTVTASDVLVRIEQERAAPPGSPEQPAP"
     MIRFESVTKR YPDGTVAVDA LDLVAETGKI TVLVGPSGCG KTTSLRMINR MIEPTSGRIW        60
     LDDRDTATIR SDQLRRGIGY VIQHAGLFPH RTVLDNITTV PRLLGRGRRE ARGQALELLE       120
     RVGLPAAFAG RYPAQLSGGQ QQRVGVARAL AADPPVMLMD EPFSAVDPVV RGQLQDEFLR       180
     LQHELRKTIV LVTHDIDEAI RLGDQVAVLR VGGRLAQLAP PGELLASPAD SFVAGFVGRD       240
     RGYRALGFTH AGELPLLDEP TVTVGAPLKS APDLARDGWV LALDEERRPL GWLATSATAE       300
     VGAATATGEG TVDADKLNLG GTLTPEAGTL REALDAALSS PSGRGVVVHA DGTFAGTVTA       360
     SDVLVRIEQE RAAPPGSPEQ PAP                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page