(data stored in ACNUC7421 zone)

EMBL: CP002299.PE107

CP002299.PE107       Location/Qualifiers
FT   CDS             127008..128087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0107"
FT                   /product="SEC-C motif domain protein"
FT                   /note="KEGG: fal:FRAAL6720 hypothetical protein; manually
FT                   curated; PFAM: SEC-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78195"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J3"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ADP78195.1"
FT                   /translation="MARRTTTARPRTSAAGAPAAGAHAADVPQVGPREQCPCGSGRRYK
FT                   ACHGAKSRPAPVLRPFAGRVDEADLVALRELIPSATAPLTLHADHLAKHPEHADRKITL
FT                   GTMLPQAAPALVRDTGEILVATQTLAPGLDPSADIAGALLAALAAEPGTVIATGPVSAL
FT                   TAVERLPEGLAGLPRLVDVLDPAPLTITVHAGFDWWLPPSEDGAGLSGEVASSLERANA
FT                   TVVPTARLSSVEAAYWTQPGDKRHLRWVLPFLEVEGVSDPDVARSRSEEQLLDALARLA
FT                   AANALSAGEGSRFVGSFRADGLVVPVWDLAPDADADSCEAPAAALRKSMDEVLAERRPL
FT                   TSEERRIRAGVVGRTLTLR"
     MARRTTTARP RTSAAGAPAA GAHAADVPQV GPREQCPCGS GRRYKACHGA KSRPAPVLRP        60
     FAGRVDEADL VALRELIPSA TAPLTLHADH LAKHPEHADR KITLGTMLPQ AAPALVRDTG       120
     EILVATQTLA PGLDPSADIA GALLAALAAE PGTVIATGPV SALTAVERLP EGLAGLPRLV       180
     DVLDPAPLTI TVHAGFDWWL PPSEDGAGLS GEVASSLERA NATVVPTARL SSVEAAYWTQ       240
     PGDKRHLRWV LPFLEVEGVS DPDVARSRSE EQLLDALARL AAANALSAGE GSRFVGSFRA       300
     DGLVVPVWDL APDADADSCE APAAALRKSM DEVLAERRPL TSEERRIRAG VVGRTLTLR        359
//

If you have problems or comments...

PBIL Back to PBIL home page