(data stored in ACNUC7421 zone)

EMBL: CP002299.PE108

CP002299.PE108       Location/Qualifiers
FT   CDS             128098..129309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0108"
FT                   /product="geranylgeranyl reductase"
FT                   /note="KEGG: fal:FRAAL6718 putative hydrogenase; TIGRFAM:
FT                   geranylgeranyl reductase; PFAM: FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78196"
FT                   /db_xref="GOA:E3J3J4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J4"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADP78196.1"
FT                   /translation="MADTSMREFDVVVIGAGPAGAAAARSAAVAGARVCLVERAELPRY
FT                   KTCGGGLVGISRDHISGAGLDLAQLARAEVDALTITLDGRYRVTRRRRDGSPIIAMVMR
FT                   PELDAALVDAARAAGVEVRTSTVVTGVRDDGPAGAVVEIRGGPDLRASVVVGADGTSSR
FT                   AAGYVGVRCDQVDLGLEAEIKAPAHVAARWERRMLLDWGPVPGSYGWVFPKGDVLTVGV
FT                   IGAREDGPALRSYYERFVAQLGLADLPRLHDSGHLTRVRADGSPVRRGRVLVAGDAAGL
FT                   LDPWTREGISFALRSGRLAGSAAAAAAGGDQGALDAYPDRVDAVFGPEVTAGRTLLGLF
FT                   TRRPEVMHGLMAGFPGAFGLFTRIIDGRSTVARQLARPGVTRTVAALSRQRNQRPDPGP
FT                   APTP"
     MADTSMREFD VVVIGAGPAG AAAARSAAVA GARVCLVERA ELPRYKTCGG GLVGISRDHI        60
     SGAGLDLAQL ARAEVDALTI TLDGRYRVTR RRRDGSPIIA MVMRPELDAA LVDAARAAGV       120
     EVRTSTVVTG VRDDGPAGAV VEIRGGPDLR ASVVVGADGT SSRAAGYVGV RCDQVDLGLE       180
     AEIKAPAHVA ARWERRMLLD WGPVPGSYGW VFPKGDVLTV GVIGAREDGP ALRSYYERFV       240
     AQLGLADLPR LHDSGHLTRV RADGSPVRRG RVLVAGDAAG LLDPWTREGI SFALRSGRLA       300
     GSAAAAAAGG DQGALDAYPD RVDAVFGPEV TAGRTLLGLF TRRPEVMHGL MAGFPGAFGL       360
     FTRIIDGRST VARQLARPGV TRTVAALSRQ RNQRPDPGPA PTP                         403
//

If you have problems or comments...

PBIL Back to PBIL home page