(data stored in ACNUC7421 zone)

EMBL: CP002299.PE114

CP002299.PE114       Location/Qualifiers
FT   CDS             140268..141185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0114"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fal:FRAAL6711 GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78202"
FT                   /db_xref="GOA:E3J3K0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP78202.1"
FT                   /translation="MSWRGEPGTDPLVGPRRFTDQAVDPAVARISGFTDRTALTRELEE
FT                   LAFRGWSALRTERVDGWVLRDSEGATRRGNSVWPHDDVADLPEALARVDRFYGRAGRPA
FT                   FVQLTPASRPSGLRQALDVAGYEPEQGPTDVCVAGLAGIVAGVAGLAERAAPPAGRARG
FT                   PVRVALAETPDDGWLDVCAAGGMSMFGQHRAASVAVLRRIETPAIYVTATVDGVPVGAG
FT                   RGVADGDWLGIYSMATLPAARGQGAATTVMAALSTWATSVGARRALLQVEEQSTAARRI
FT                   YAALGFLPVYRYTYRRRATGPAAP"
     MSWRGEPGTD PLVGPRRFTD QAVDPAVARI SGFTDRTALT RELEELAFRG WSALRTERVD        60
     GWVLRDSEGA TRRGNSVWPH DDVADLPEAL ARVDRFYGRA GRPAFVQLTP ASRPSGLRQA       120
     LDVAGYEPEQ GPTDVCVAGL AGIVAGVAGL AERAAPPAGR ARGPVRVALA ETPDDGWLDV       180
     CAAGGMSMFG QHRAASVAVL RRIETPAIYV TATVDGVPVG AGRGVADGDW LGIYSMATLP       240
     AARGQGAATT VMAALSTWAT SVGARRALLQ VEEQSTAARR IYAALGFLPV YRYTYRRRAT       300
     GPAAP                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page