(data stored in ACNUC7421 zone)

EMBL: CP002299.PE12

CP002299.PE12        Location/Qualifiers
FT   CDS             complement(16799..18517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0012"
FT                   /product="Pyrrolo-quinoline quinone beta-propeller repeat
FT                   protein"
FT                   /note="SMART: Pyrrolo-quinoline quinone beta-propeller
FT                   repeat; KEGG: fal:FRAAL0397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78100"
FT                   /db_xref="GOA:E3J262"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:E3J262"
FT                   /inference="protein motif:SMART:SM00564"
FT                   /protein_id="ADP78100.1"
FT                   /translation="MDAEFSATAAAPGADQPWAAPTADLPAGLGQAEAAQRVQAALGSP
FT                   TTQAAQGSPTTEAPPTTPATQAILASPPAQATPTAEAAHPTPATRTTRGANPPNLPNSA
FT                   GRSGRRPWLALTVTAGLVVQLALIGTGIGVAVVATRDRGPETVGQAWSSDLVALGKPVA
FT                   ARGSVLVFSSTDENLVDRIAALDPATGRARWTAPASISRIEGDLGQFTPLVVDNGATVV
FT                   WLTPAGADDTVSVVAADAATGERRWSYGEDLSVASSPRVCENGSAICLVAAADDDAGPL
FT                   SKVVLDARSGRVRLEAPLRIGSDTREVGDDLVLSGNDETLAAVADDGTMIWQEPATKVF
FT                   GATADGVVFIGMDSVRRGDVYVGSPVNGLLADSLAPVAQTDLNALVGIRATTGERVWTR
FT                   PGATLGCPRIAFDPAHPVRCVFRGTVTSGLNADYENFGVTLEGFDLETGETTWSWDARD
FT                   AWVFTDAFGAGLAARGQSGDFVLRAGATRYVLRVRGETTVLDLGRGPVSAETPATGWCT
FT                   TWSSRWSGVEWPYACDTAGRDALPSAPVEFGGVRVGDNYVWLDRDGRPRGGPITS"
     MDAEFSATAA APGADQPWAA PTADLPAGLG QAEAAQRVQA ALGSPTTQAA QGSPTTEAPP        60
     TTPATQAILA SPPAQATPTA EAAHPTPATR TTRGANPPNL PNSAGRSGRR PWLALTVTAG       120
     LVVQLALIGT GIGVAVVATR DRGPETVGQA WSSDLVALGK PVAARGSVLV FSSTDENLVD       180
     RIAALDPATG RARWTAPASI SRIEGDLGQF TPLVVDNGAT VVWLTPAGAD DTVSVVAADA       240
     ATGERRWSYG EDLSVASSPR VCENGSAICL VAAADDDAGP LSKVVLDARS GRVRLEAPLR       300
     IGSDTREVGD DLVLSGNDET LAAVADDGTM IWQEPATKVF GATADGVVFI GMDSVRRGDV       360
     YVGSPVNGLL ADSLAPVAQT DLNALVGIRA TTGERVWTRP GATLGCPRIA FDPAHPVRCV       420
     FRGTVTSGLN ADYENFGVTL EGFDLETGET TWSWDARDAW VFTDAFGAGL AARGQSGDFV       480
     LRAGATRYVL RVRGETTVLD LGRGPVSAET PATGWCTTWS SRWSGVEWPY ACDTAGRDAL       540
     PSAPVEFGGV RVGDNYVWLD RDGRPRGGPI TS                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page