(data stored in ACNUC7421 zone)

EMBL: CP002299.PE125

CP002299.PE125       Location/Qualifiers
FT   CDS             complement(153237..154211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0125"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   fal:FRAAL5881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78213"
FT                   /db_xref="GOA:E3J4P4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P4"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADP78213.1"
FT                   /translation="MAVVTKVLVVLAWVAAAGLAVAVLGRLTHLDDVLWPYVLVNALTP
FT                   VLFLPAYPAFAVGVATHRYALAAVALVAVVAHLVWLWPEVRPGSASAAPAGSAQFRLLT
FT                   TNLEMDNGRAGTLGRQIRADSPDVVVVEELSNVTYYGLMKSGALAGYHYSASRPQFGAF
FT                   GAGVWSRYPLSDVAAPLVGGLDSLRVTVTLPTGQRFRLFAVHTLSPQSSSNVRVWRTQL
FT                   ADLRREVRATTLPVVLAGDFNATRDMRPFRNVLAAGVTDAHDDVHAGWAPTWNAHFPIL
FT                   PPVWRLDHVLISPQFTATGLRVGKSYGSDHLPLVADLALRPSS"
     MAVVTKVLVV LAWVAAAGLA VAVLGRLTHL DDVLWPYVLV NALTPVLFLP AYPAFAVGVA        60
     THRYALAAVA LVAVVAHLVW LWPEVRPGSA SAAPAGSAQF RLLTTNLEMD NGRAGTLGRQ       120
     IRADSPDVVV VEELSNVTYY GLMKSGALAG YHYSASRPQF GAFGAGVWSR YPLSDVAAPL       180
     VGGLDSLRVT VTLPTGQRFR LFAVHTLSPQ SSSNVRVWRT QLADLRREVR ATTLPVVLAG       240
     DFNATRDMRP FRNVLAAGVT DAHDDVHAGW APTWNAHFPI LPPVWRLDHV LISPQFTATG       300
     LRVGKSYGSD HLPLVADLAL RPSS                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page