(data stored in ACNUC7421 zone)

EMBL: CP002299.PE127

CP002299.PE127       Location/Qualifiers
FT   CDS             155915..157669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0127"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; GMC oxidoreductase;
FT                   KEGG: mes:Meso_2585 glucose-methanol-choline
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78215"
FT                   /db_xref="GOA:E3J4P6"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P6"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADP78215.1"
FT                   /translation="MTVFDLDKLPPDTELTTEVCIVGSGPAGATLAAELAGSSLRVLVV
FT                   ESGGREPEAAVAALNEVENVGAARVADQALMRTRALGGTSRIWTGRCGELDEIDYADRP
FT                   WVAHSGWPVTGSELRPFLDRARPYLGLGPNLYDERLWAVLGRRPARPPLPEARLVPRFW
FT                   QFSRGVTDPAGPTRFGLDVLPDAVGDDAVDEPRGLAGAGNVNVLLHATVTHIDTDDTGA
FT                   VVRGVEVASTSGRQARIRAAVVVLAAGGIENARLMLASNRVVPHGVGNGNDLVGRFLMD
FT                   HPGSVIASVDPGSARRLRDRFGRYWLDGPDGRQVYLHGVGLSPKAQRDAELLNCAAFLE
FT                   EYPAPGDPWHAGQRLASRLRGGGGPAQDEVALASFWRREDEVPEPTAVRDALTLARNAP
FT                   ALATGAYRMTRRHRPPIFQASRVDLYCLVEQEPDPSSRVTLSDRVDGLGVPLSRVDWRV
FT                   SERERTSIGRLAGLLAQELGSLGYASPEPAVWLKGGDAWRENVIDRAHPIGTTRMADDP
FT                   RAGVVDRNCQVHDTEGLFVAGSSTFPTAGHVNPTLTIVALAIRLADHLKARGRADQLAW
FT                   APSPSVSS"
     MTVFDLDKLP PDTELTTEVC IVGSGPAGAT LAAELAGSSL RVLVVESGGR EPEAAVAALN        60
     EVENVGAARV ADQALMRTRA LGGTSRIWTG RCGELDEIDY ADRPWVAHSG WPVTGSELRP       120
     FLDRARPYLG LGPNLYDERL WAVLGRRPAR PPLPEARLVP RFWQFSRGVT DPAGPTRFGL       180
     DVLPDAVGDD AVDEPRGLAG AGNVNVLLHA TVTHIDTDDT GAVVRGVEVA STSGRQARIR       240
     AAVVVLAAGG IENARLMLAS NRVVPHGVGN GNDLVGRFLM DHPGSVIASV DPGSARRLRD       300
     RFGRYWLDGP DGRQVYLHGV GLSPKAQRDA ELLNCAAFLE EYPAPGDPWH AGQRLASRLR       360
     GGGGPAQDEV ALASFWRRED EVPEPTAVRD ALTLARNAPA LATGAYRMTR RHRPPIFQAS       420
     RVDLYCLVEQ EPDPSSRVTL SDRVDGLGVP LSRVDWRVSE RERTSIGRLA GLLAQELGSL       480
     GYASPEPAVW LKGGDAWREN VIDRAHPIGT TRMADDPRAG VVDRNCQVHD TEGLFVAGSS       540
     TFPTAGHVNP TLTIVALAIR LADHLKARGR ADQLAWAPSP SVSS                        584
//

If you have problems or comments...

PBIL Back to PBIL home page