(data stored in ACNUC7421 zone)

EMBL: CP002299.PE129

CP002299.PE129       Location/Qualifiers
FT   CDS             complement(159218..162343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78217"
FT                   /db_xref="GOA:E3J4P8"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P8"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05770"
FT                   /protein_id="ADP78217.1"
FT                   /translation="MPPADNEPTVRVEIPPAPLGGDERPAARKPSTGQEQTTRVKRPQV
FT                   TTDRAAPGAGKPTTTATEDSAATAEANPPKAHNQDKPTTASDRRPPVAATPPRRPATSR
FT                   TVPPAAGDEPAPAAEKAKAELRPTDGQQPAAPSETKPAAPADTKATTPVSERPAASADT
FT                   KPAAPVDRKATAPADRKPATPGGRRPAAPAAEEPTTRIDRRPAADAGTKRPAPADPRPA
FT                   TPAIRTPPAPVGARPAAPGGERPPAPAATKPATPVETKPPAAEAPTAPPDAGTPAGTGE
FT                   SQLLPEYVTRLRPLLKPPPAAVPEPAPAGSRIQRIRDALADVLWWNSAYQPADPERAAE
FT                   TLHGRLLLSGASLLSFTVGVLSVAAGLTHLRIAALLVFCLIGIGSAPWALDTRMRLTTR
FT                   MAMTTLVSFSVLTFVATFMLSLGRWHPALAFTLVSLICVPLHWIGFRRAVVERRDARPA
FT                   VDLTPLRDGTWNDVVDRLRLREFSALYCAVAGAVLCMYAALRHRHIVDPGVYGYLTHVG
FT                   PAWYLGLALIVVAIVIAPRADERVMAAVVLLLVVAVLLTPSLVYDAPRQPSATKHVDLV
FT                   QQIRHAHHLDALVLVYNGWAGMFAAMAWLCDITGIREPMGLATFWPPLIGFFKVLALRY
FT                   FAGKVLPTAYQAWIAVILGVLADTIGADYFSPQSVGYVIGLVAFGLALSHRRSVQRTLL
FT                   LVSAGLLISVTHQLSPYIVGGALVILVVFRQIRPWWTPVTVLGPAAAWALLHWSQVKGF
FT                   INLHDIGSSQNFHPPKTAGAVGLVRQPIVGETVHALMLGVGLIGLIGGLAVLRNRRTGA
FT                   VWAYACCPAVGLVVVAVNPYGNEGIFRAILFALPWLSVLAARMFTSKRRLLPRIPLLAV
FT                   MATMTATFLVAAFGLDDINVVRWSDLNTLRYFQTVGYSNSPANAYYVLQLGAGDLPASI
FT                   PTRTNSHRPLKIEDLQDAQAANVDLPPATRMRILTSRLITYSGEPASQARIYTIWSPVS
FT                   SEYGYDYGVETPAEFAELRDAFAAAPYWSIAKDLDGTVLFKFEPARYPVPTP"
     MPPADNEPTV RVEIPPAPLG GDERPAARKP STGQEQTTRV KRPQVTTDRA APGAGKPTTT        60
     ATEDSAATAE ANPPKAHNQD KPTTASDRRP PVAATPPRRP ATSRTVPPAA GDEPAPAAEK       120
     AKAELRPTDG QQPAAPSETK PAAPADTKAT TPVSERPAAS ADTKPAAPVD RKATAPADRK       180
     PATPGGRRPA APAAEEPTTR IDRRPAADAG TKRPAPADPR PATPAIRTPP APVGARPAAP       240
     GGERPPAPAA TKPATPVETK PPAAEAPTAP PDAGTPAGTG ESQLLPEYVT RLRPLLKPPP       300
     AAVPEPAPAG SRIQRIRDAL ADVLWWNSAY QPADPERAAE TLHGRLLLSG ASLLSFTVGV       360
     LSVAAGLTHL RIAALLVFCL IGIGSAPWAL DTRMRLTTRM AMTTLVSFSV LTFVATFMLS       420
     LGRWHPALAF TLVSLICVPL HWIGFRRAVV ERRDARPAVD LTPLRDGTWN DVVDRLRLRE       480
     FSALYCAVAG AVLCMYAALR HRHIVDPGVY GYLTHVGPAW YLGLALIVVA IVIAPRADER       540
     VMAAVVLLLV VAVLLTPSLV YDAPRQPSAT KHVDLVQQIR HAHHLDALVL VYNGWAGMFA       600
     AMAWLCDITG IREPMGLATF WPPLIGFFKV LALRYFAGKV LPTAYQAWIA VILGVLADTI       660
     GADYFSPQSV GYVIGLVAFG LALSHRRSVQ RTLLLVSAGL LISVTHQLSP YIVGGALVIL       720
     VVFRQIRPWW TPVTVLGPAA AWALLHWSQV KGFINLHDIG SSQNFHPPKT AGAVGLVRQP       780
     IVGETVHALM LGVGLIGLIG GLAVLRNRRT GAVWAYACCP AVGLVVVAVN PYGNEGIFRA       840
     ILFALPWLSV LAARMFTSKR RLLPRIPLLA VMATMTATFL VAAFGLDDIN VVRWSDLNTL       900
     RYFQTVGYSN SPANAYYVLQ LGAGDLPASI PTRTNSHRPL KIEDLQDAQA ANVDLPPATR       960
     MRILTSRLIT YSGEPASQAR IYTIWSPVSS EYGYDYGVET PAEFAELRDA FAAAPYWSIA      1020
     KDLDGTVLFK FEPARYPVPT P                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page