(data stored in ACNUC7421 zone)

EMBL: CP002299.PE13

CP002299.PE13        Location/Qualifiers
FT   CDS             19371..19547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_4501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78101"
FT                   /db_xref="UniProtKB/TrEMBL:E3J263"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_4501"
FT                   /protein_id="ADP78101.1"
FT                   /translation="MLAKPVKPGTPAPASGQYRPKGGGAEVTVPKGHRLPPTPRPGQVW
FT                   KIVDRTKNASGRG"
     MLAKPVKPGT PAPASGQYRP KGGGAEVTVP KGHRLPPTPR PGQVWKIVDR TKNASGRG          58
//

If you have problems or comments...

PBIL Back to PBIL home page