(data stored in ACNUC7421 zone)

EMBL: CP002299.PE134

CP002299.PE134       Location/Qualifiers
FT   CDS             171868..172953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0134"
FT                   /product="Scramblase family protein"
FT                   /note="PFAM: Scramblase family protein; Protein of unknown
FT                   function DUF2510; KEGG: fal:FRAAL4219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78222"
FT                   /db_xref="GOA:E3J4Q3"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q3"
FT                   /inference="protein motif:PFAM:PF03803"
FT                   /protein_id="ADP78222.1"
FT                   /translation="MSQNSPVPGWYPDPSGAPGTRWWDGVQWTGHTQAPPTQPPAAPVP
FT                   QQQPTPAPAPQQPAAPVLYQKPPQPQGAFQPAGAPPQQQPGGFPPGPGPQGPGWQQGPQ
FT                   GHPGPQGHPGAPGQPGAPGWGTAQGNFPPAPVHTGFTPDKIQEQVQQRAGVAPSGPGGG
FT                   TIFTEPVLVVNQKTQFIEVTNQYAIFDQGGRQIGSVVEVGQSTAKKVARVLTSLDQYMT
FT                   HKLEVRDPAGNVMLVLTRPAKLVKSKVVVTRPDGSEIGQIVQQNAIGKIRFGLMVGGQQ
FT                   IGLIKAENWRAWNFSIVDHAEVEVARITKTWEGLLKTMFTTADNYVVQLHFQLPDPLLS
FT                   LVIASALTVDTALKQDSRGWN"
     MSQNSPVPGW YPDPSGAPGT RWWDGVQWTG HTQAPPTQPP AAPVPQQQPT PAPAPQQPAA        60
     PVLYQKPPQP QGAFQPAGAP PQQQPGGFPP GPGPQGPGWQ QGPQGHPGPQ GHPGAPGQPG       120
     APGWGTAQGN FPPAPVHTGF TPDKIQEQVQ QRAGVAPSGP GGGTIFTEPV LVVNQKTQFI       180
     EVTNQYAIFD QGGRQIGSVV EVGQSTAKKV ARVLTSLDQY MTHKLEVRDP AGNVMLVLTR       240
     PAKLVKSKVV VTRPDGSEIG QIVQQNAIGK IRFGLMVGGQ QIGLIKAENW RAWNFSIVDH       300
     AEVEVARITK TWEGLLKTMF TTADNYVVQL HFQLPDPLLS LVIASALTVD TALKQDSRGW       360
     N                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page