(data stored in ACNUC7421 zone)

EMBL: CP002299.PE135

CP002299.PE135       Location/Qualifiers
FT   CDS             173091..173801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0135"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   fal:FRAAL6702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78223"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q4"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADP78223.1"
FT                   /translation="MTPTSGPPEARKKNLFAPPPAGAVTQPSRRRLPTVALPAPPVTVA
FT                   ALDAIDADDGRVELLDGLCVLRPWPTPLRTRVTQRLAELLTAAAPSGAHVFPHGLRVEI
FT                   SARTLVIPDLVVGPVPTPTGPPADADPSATPSPAATTPARITEPPFLVIEVADEHTRRY
FT                   NRTLKLDLYRDRGIPSCWLVDPDPAGRTVTIEIYDLVDGGYVRAGQASEATPLSVTRPF
FT                   PVTFIPADLVDPGD"
     MTPTSGPPEA RKKNLFAPPP AGAVTQPSRR RLPTVALPAP PVTVAALDAI DADDGRVELL        60
     DGLCVLRPWP TPLRTRVTQR LAELLTAAAP SGAHVFPHGL RVEISARTLV IPDLVVGPVP       120
     TPTGPPADAD PSATPSPAAT TPARITEPPF LVIEVADEHT RRYNRTLKLD LYRDRGIPSC       180
     WLVDPDPAGR TVTIEIYDLV DGGYVRAGQA SEATPLSVTR PFPVTFIPAD LVDPGD           236
//

If you have problems or comments...

PBIL Back to PBIL home page