(data stored in ACNUC7421 zone)

EMBL: CP002299.PE136

CP002299.PE136       Location/Qualifiers
FT   CDS             complement(174270..175889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0136"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: fal:FRAAL6701 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78224"
FT                   /db_xref="GOA:E3J4Q5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q5"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADP78224.1"
FT                   /translation="MPKIIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGV
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTNDVAGDGTTTATILAQALVREGLR
FT                   NVAAGANPLGLKKGIELAVESVSEELSKQAKEIETKEQIASTASISAGDPAIGALIAEA
FT                   LDKVGKEGVVTVEESNTFGLELELTEGMRFDKGYISPYFVTDADRQEAVLDDPYILIVN
FT                   SKISAVKDLLPLLEKVMQASKPLVIISEDVEGEALATLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLGDIAILTGGQVISEDVGLKLESTSIDLLGKARKVVVTKDETTIVEGAGDADQI
FT                   TGRVSQIRNEIDKSDSDYDREKLQERLAKLAGGVAVVKVGAATEVELKEKKHRIEDAVS
FT                   NAKAAVEEGIVAGGGVALLQASVSAFDKLDLTGDEATGANIVRLALEAPIKQIAFNSGL
FT                   EGGVVVDKVRNLPIGHGLNAATGEYVDMLATGIIDPAKVTRSALQNAASIAGLFLTTEA
FT                   VIADKPEKNPAPAMPGGGDMDF"
     MPKIIAFDEE ARRGLERGMN QLADAVKVTL GPKGRNVVLE KKWGVPTITN DGVSIAKEIE        60
     LEDPYEKIGA ELVKEVAKKT NDVAGDGTTT ATILAQALVR EGLRNVAAGA NPLGLKKGIE       120
     LAVESVSEEL SKQAKEIETK EQIASTASIS AGDPAIGALI AEALDKVGKE GVVTVEESNT       180
     FGLELELTEG MRFDKGYISP YFVTDADRQE AVLDDPYILI VNSKISAVKD LLPLLEKVMQ       240
     ASKPLVIISE DVEGEALATL VVNKIRGTFK SVAVKAPGFG DRRKAMLGDI AILTGGQVIS       300
     EDVGLKLEST SIDLLGKARK VVVTKDETTI VEGAGDADQI TGRVSQIRNE IDKSDSDYDR       360
     EKLQERLAKL AGGVAVVKVG AATEVELKEK KHRIEDAVSN AKAAVEEGIV AGGGVALLQA       420
     SVSAFDKLDL TGDEATGANI VRLALEAPIK QIAFNSGLEG GVVVDKVRNL PIGHGLNAAT       480
     GEYVDMLATG IIDPAKVTRS ALQNAASIAG LFLTTEAVIA DKPEKNPAPA MPGGGDMDF        539
//

If you have problems or comments...

PBIL Back to PBIL home page