(data stored in ACNUC7421 zone)

EMBL: CP002299.PE140

CP002299.PE140       Location/Qualifiers
FT   CDS             complement(181105..182025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0140"
FT                   /product="trehalose-phosphatase"
FT                   /note="KEGG: fal:FRAAL6697 trehalose-phosphatase; TIGRFAM:
FT                   trehalose-phosphatase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78228"
FT                   /db_xref="GOA:E3J4Q9"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q9"
FT                   /inference="protein motif:TFAM:TIGR00685"
FT                   /protein_id="ADP78228.1"
FT                   /translation="MTTSPAPAPRIPPASAPTVGAPTEPPDSAPTPGFGLPGGAALAAL
FT                   ITAPGHALVALDYDGTLAPIMPRPMDAAPAPGAVDALRALASRVGTLAIITGRPVDALL
FT                   ELTGLPTAGAGEDGLANLTILGQYGLQRWEGATGDTVSPEPLPGVAAVRARLPEVLRDA
FT                   PPGVTVEDKGQALVIHVRRAADPDAALGALAPALRRLAEEHGLEAAPGKKVLELRPPDH
FT                   DKGRALRELVDERSARSVLMAGDDLGDLPAFDAVEALRSTGIAGLTVCSDGPEVPTALR
FT                   ERADLVVDGPAGIVALLQVLAARIG"
     MTTSPAPAPR IPPASAPTVG APTEPPDSAP TPGFGLPGGA ALAALITAPG HALVALDYDG        60
     TLAPIMPRPM DAAPAPGAVD ALRALASRVG TLAIITGRPV DALLELTGLP TAGAGEDGLA       120
     NLTILGQYGL QRWEGATGDT VSPEPLPGVA AVRARLPEVL RDAPPGVTVE DKGQALVIHV       180
     RRAADPDAAL GALAPALRRL AEEHGLEAAP GKKVLELRPP DHDKGRALRE LVDERSARSV       240
     LMAGDDLGDL PAFDAVEALR STGIAGLTVC SDGPEVPTAL RERADLVVDG PAGIVALLQV       300
     LAARIG                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page