(data stored in ACNUC7421 zone)

EMBL: CP002299.PE141

CP002299.PE141       Location/Qualifiers
FT   CDS             complement(182377..183009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78229"
FT                   /db_xref="GOA:E3J4R0"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6696"
FT                   /protein_id="ADP78229.1"
FT                   /translation="MSGPGSTTTAARSAAAPPPRRPTGNSRLRALGAALIAVLAVGVGI
FT                   LLVNLLHNPKSGAQPPTASRASTAAPVTSATPRATASAHPTSATSSARPSASSPRPTTQ
FT                   PPAGSGAVAPVVILNDSKIEGLADAASGPVKDAGFTVDRVGGYISTYNVPVTTVFYEDD
FT                   LKAAAQNLQQRVSGIVKIEPIAGTDIKLYEPGKLILVVTRDFPTPAP"
     MSGPGSTTTA ARSAAAPPPR RPTGNSRLRA LGAALIAVLA VGVGILLVNL LHNPKSGAQP        60
     PTASRASTAA PVTSATPRAT ASAHPTSATS SARPSASSPR PTTQPPAGSG AVAPVVILND       120
     SKIEGLADAA SGPVKDAGFT VDRVGGYIST YNVPVTTVFY EDDLKAAAQN LQQRVSGIVK       180
     IEPIAGTDIK LYEPGKLILV VTRDFPTPAP                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page