(data stored in ACNUC7421 zone)

EMBL: CP002299.PE145

CP002299.PE145       Location/Qualifiers
FT   CDS             complement(185618..186871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0145"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region; KEGG: fal:FRAAL6693
FT                   glutamate dehydrogenase (GDH)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78233"
FT                   /db_xref="GOA:E3J4R4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R4"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ADP78233.1"
FT                   /translation="MSLGSSPWDTACVQLADAARHLGLDEGMHDLLRMPRRSVTVSVPL
FT                   RRDDGQLLVLTGYRVQHNLARGPAKGGIRFHPSTDLDEVKALAMWMTWKCALMGIPYGG
FT                   AKGGIAVEPKMLSDQERERMTRRYAAELVPLIGPEKDIPAPDVGTDEQTMAWIMDTYSA
FT                   HTGHTSHGVVTGKPLSVGGSAGRAGATSRGVQLAMFAALRERGLDPADVSVAIQGFGKV
FT                   GALAAQYLHDAGCRVVAVSDVKGGVYNPRGLNPTALIRHLARGADTVVGFPGTDTLSNS
FT                   ELLELDVDVLVPAALEGVITAENAGRVRARMIVEGANGPVAAEADPILAEKGVVVVPDI
FT                   LANGGGVAVSYFEWVQDLQAYFWTEDQVNERLAELMERAYAQVSRLAAERGLTLRAAAH
FT                   VIGVGRVAEAHRTRGLYP"
     MSLGSSPWDT ACVQLADAAR HLGLDEGMHD LLRMPRRSVT VSVPLRRDDG QLLVLTGYRV        60
     QHNLARGPAK GGIRFHPSTD LDEVKALAMW MTWKCALMGI PYGGAKGGIA VEPKMLSDQE       120
     RERMTRRYAA ELVPLIGPEK DIPAPDVGTD EQTMAWIMDT YSAHTGHTSH GVVTGKPLSV       180
     GGSAGRAGAT SRGVQLAMFA ALRERGLDPA DVSVAIQGFG KVGALAAQYL HDAGCRVVAV       240
     SDVKGGVYNP RGLNPTALIR HLARGADTVV GFPGTDTLSN SELLELDVDV LVPAALEGVI       300
     TAENAGRVRA RMIVEGANGP VAAEADPILA EKGVVVVPDI LANGGGVAVS YFEWVQDLQA       360
     YFWTEDQVNE RLAELMERAY AQVSRLAAER GLTLRAAAHV IGVGRVAEAH RTRGLYP          417
//

If you have problems or comments...

PBIL Back to PBIL home page