(data stored in ACNUC7421 zone)

EMBL: CP002299.PE146

CP002299.PE146       Location/Qualifiers
FT   CDS             187181..188857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78234"
FT                   /db_xref="GOA:E3J4R5"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6692"
FT                   /protein_id="ADP78234.1"
FT                   /translation="MAAAPVIGPDPGSGAAHQRGPAGDDGGSTADHAQATGARPAHLAE
FT                   GRSGADGRPGTGRLGRAVTRWRAPWSATRLWGFWAVTRLLLLALVWAGHPLGAQQGVLG
FT                   DVRLYDGWGTAFIHGHGLPVGDQKWQYPPGAVLVFAVPALAHALVLLPYRVGFPLLMLA
FT                   VDAGVTTALARVRGPDVGGLPAGSPGSRLPTATPAPALPGPGARVWLVGTTLLGPVTLA
FT                   RFDLVPAACAVAGLLLLVPARRGGAGISGPRYGRAGFAAAVGALVKAWPAFLLIALGRA
FT                   ALVPQVSAEAPAGPAIWRRLWSRPLVRAGAGAVGAALLVGLLLVGAGAGGDLFGFLGAQ
FT                   RARGLQLEAVPATVFVVIRMFGVGETAHYEYGSLQFGDPAARTVATACSLVEIAVVAVV
FT                   AVRWWLARPAPVPGRAPARGPAATVGDRLLALLLVLLVTSRVLSPQYLIWVLAVAAAVA
FT                   ALGATEPPDGDLGADPAQAHRRAALALLLAVAAISQLIYPWRYNDIIEGRPVTSLVLVA
FT                   RNVLLLAACWRAVLVIAWRPAGRRPRGRARTDAAAPSDPSS"
     MAAAPVIGPD PGSGAAHQRG PAGDDGGSTA DHAQATGARP AHLAEGRSGA DGRPGTGRLG        60
     RAVTRWRAPW SATRLWGFWA VTRLLLLALV WAGHPLGAQQ GVLGDVRLYD GWGTAFIHGH       120
     GLPVGDQKWQ YPPGAVLVFA VPALAHALVL LPYRVGFPLL MLAVDAGVTT ALARVRGPDV       180
     GGLPAGSPGS RLPTATPAPA LPGPGARVWL VGTTLLGPVT LARFDLVPAA CAVAGLLLLV       240
     PARRGGAGIS GPRYGRAGFA AAVGALVKAW PAFLLIALGR AALVPQVSAE APAGPAIWRR       300
     LWSRPLVRAG AGAVGAALLV GLLLVGAGAG GDLFGFLGAQ RARGLQLEAV PATVFVVIRM       360
     FGVGETAHYE YGSLQFGDPA ARTVATACSL VEIAVVAVVA VRWWLARPAP VPGRAPARGP       420
     AATVGDRLLA LLLVLLVTSR VLSPQYLIWV LAVAAAVAAL GATEPPDGDL GADPAQAHRR       480
     AALALLLAVA AISQLIYPWR YNDIIEGRPV TSLVLVARNV LLLAACWRAV LVIAWRPAGR       540
     RPRGRARTDA AAPSDPSS                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page