(data stored in ACNUC7421 zone)

EMBL: CP002299.PE148

CP002299.PE148       Location/Qualifiers
FT   CDS             190892..192775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0148"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: fal:FRAAL6690 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78236"
FT                   /db_xref="GOA:E3J4R7"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6690"
FT                   /protein_id="ADP78236.1"
FT                   /translation="MPSRPALGDEPGRSLPSSSSFVGTAPSAATGPSTIELPRTAGAPT
FT                   DEAVADPPIQGIVPGPPTGTGHAPQDPTRVGETVGPTDDRALPAGRAGRAGGGWRLVRL
FT                   VAVQVGQLVRARPWLLTAALCALSLGLGLTGPDTPAQEYRVWLFEHGGARLWDDQWYGG
FT                   HTIPGYSVLFPPLGALFGAQLLAALSCVASTVLVARLLRGPRARRGHDLPVLWFGVVTV
FT                   ADLIVGRGPFALGLAFGALAVVGVRERRWWVALIGAVCSSLASPLAGAFVLLVGVALIG
FT                   SLSWRRIWPLVGAICGILVSLIFPEEGTQPFPALTYLSLLTLIVAGLLVVPRRERAVRR
FT                   GLLLWAMAATVFFLLPTTVGGNITRPATLLAGPMAAVLLSKRPKILLIVAVPLIGWSIG
FT                   PVQGALATQGDPSAASSYYSGMLDYLDRGGPVPVGRVEVPFTQAHWEARYVAPKVPMAR
FT                   GWLRQLDSKYNSLFYDGTLTAKTYHDWLLARGVTYVALPDVPLDPSAQAEAVLLRSGLP
FT                   YLQLGWSNAHWKIWIVTDASGLVQGPAQLTELGVSSMAVNFDRPGLATVLVHYTSFWSI
FT                   TEGNACVFKAAGNWTGILASEAGPVRLGTHLSVDGLTHASELDCPTDQRVH"
     MPSRPALGDE PGRSLPSSSS FVGTAPSAAT GPSTIELPRT AGAPTDEAVA DPPIQGIVPG        60
     PPTGTGHAPQ DPTRVGETVG PTDDRALPAG RAGRAGGGWR LVRLVAVQVG QLVRARPWLL       120
     TAALCALSLG LGLTGPDTPA QEYRVWLFEH GGARLWDDQW YGGHTIPGYS VLFPPLGALF       180
     GAQLLAALSC VASTVLVARL LRGPRARRGH DLPVLWFGVV TVADLIVGRG PFALGLAFGA       240
     LAVVGVRERR WWVALIGAVC SSLASPLAGA FVLLVGVALI GSLSWRRIWP LVGAICGILV       300
     SLIFPEEGTQ PFPALTYLSL LTLIVAGLLV VPRRERAVRR GLLLWAMAAT VFFLLPTTVG       360
     GNITRPATLL AGPMAAVLLS KRPKILLIVA VPLIGWSIGP VQGALATQGD PSAASSYYSG       420
     MLDYLDRGGP VPVGRVEVPF TQAHWEARYV APKVPMARGW LRQLDSKYNS LFYDGTLTAK       480
     TYHDWLLARG VTYVALPDVP LDPSAQAEAV LLRSGLPYLQ LGWSNAHWKI WIVTDASGLV       540
     QGPAQLTELG VSSMAVNFDR PGLATVLVHY TSFWSITEGN ACVFKAAGNW TGILASEAGP       600
     VRLGTHLSVD GLTHASELDC PTDQRVH                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page