(data stored in ACNUC7421 zone)

EMBL: CP002299.PE149

CP002299.PE149       Location/Qualifiers
FT   CDS             193263..194690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0149"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: fal:FRAAL6686 hypothetical protein; PFAM:
FT                   Stage II sporulation protein E; SMART: protein phosphatase
FT                   2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78237"
FT                   /db_xref="GOA:E3J4R8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R8"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADP78237.1"
FT                   /translation="MKSSLLPIMLIVVLVVGATVFVVLSSRSGRTTYGPGAQPPPTQDG
FT                   SRARRRGRNDGSRRDIGRPIRRGGGSTFGPPDVEYSDPGDLVPGLGQRPAAAPAPDVDA
FT                   RRVDPALGQAWRDDVTTQVPTDGGWPADDRDPDATGWAPPPSGAPHPRAAETGPTPVGG
FT                   QDAAPTIEDDAWNLPAGRDSHQQPAAPASWLEAAPPPAEPPPAPAAPLAPAVAPSAAAD
FT                   ATMVTATAGPYVADEPEHFSSSPLRLAAAGRTRRGKRGGPNEDAFVVVDGLLAVADGVG
FT                   GEAAGQIASTLAVTTVAGFRPQYADDPSEGLRAAVVRANKMVRERPKAEPSWRGMACTL
FT                   DVVVLGRQEQTGRTITVAHVGDSTVWLQAGKGEPRQLTTPHAITGGPLLNAIGLADEVE
FT                   MDLFQVAVQAGDRVVLSSDGMTKVMKPEQLYGLLHQLANDPPERAADALVEAALLAGAR
FT                   DDTTVVVADLVPEPAPR"
     MKSSLLPIML IVVLVVGATV FVVLSSRSGR TTYGPGAQPP PTQDGSRARR RGRNDGSRRD        60
     IGRPIRRGGG STFGPPDVEY SDPGDLVPGL GQRPAAAPAP DVDARRVDPA LGQAWRDDVT       120
     TQVPTDGGWP ADDRDPDATG WAPPPSGAPH PRAAETGPTP VGGQDAAPTI EDDAWNLPAG       180
     RDSHQQPAAP ASWLEAAPPP AEPPPAPAAP LAPAVAPSAA ADATMVTATA GPYVADEPEH       240
     FSSSPLRLAA AGRTRRGKRG GPNEDAFVVV DGLLAVADGV GGEAAGQIAS TLAVTTVAGF       300
     RPQYADDPSE GLRAAVVRAN KMVRERPKAE PSWRGMACTL DVVVLGRQEQ TGRTITVAHV       360
     GDSTVWLQAG KGEPRQLTTP HAITGGPLLN AIGLADEVEM DLFQVAVQAG DRVVLSSDGM       420
     TKVMKPEQLY GLLHQLANDP PERAADALVE AALLAGARDD TTVVVADLVP EPAPR            475
//

If you have problems or comments...

PBIL Back to PBIL home page