(data stored in ACNUC7421 zone)

EMBL: CP002299.PE15

CP002299.PE15        Location/Qualifiers
FT   CDS             complement(21125..21799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0015"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /note="PFAM: Phenazine biosynthesis PhzC/PhzF protein;
FT                   KEGG: cai:Caci_7069 phenazine biosynthesis PhzC/PhzF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78103"
FT                   /db_xref="GOA:E3J265"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:E3J265"
FT                   /inference="protein motif:PFAM:PF02567"
FT                   /protein_id="ADP78103.1"
FT                   /translation="MVTAHVVRVFSDEHGHGGNPLGVIEDPGNLGPDERQAIAKTLGYS
FT                   ETIFLDDVEKAEISIHNLSRQIPFAGHAAVGAAWTIARLTGHHPSVLRTTGREAESWAD
FT                   SAGVWVRAPLSMTPPWWAERLDDPREVDDLDGPLSPTQDFTQLWAWIDEPAGIARMRTY
FT                   AARVGIPEDEACGTGAMRLAAALGRRMTIHHGEGSVIYAAPGPAGYADIGGHVTEDPPR
FT                   QL"
     MVTAHVVRVF SDEHGHGGNP LGVIEDPGNL GPDERQAIAK TLGYSETIFL DDVEKAEISI        60
     HNLSRQIPFA GHAAVGAAWT IARLTGHHPS VLRTTGREAE SWADSAGVWV RAPLSMTPPW       120
     WAERLDDPRE VDDLDGPLSP TQDFTQLWAW IDEPAGIARM RTYAARVGIP EDEACGTGAM       180
     RLAAALGRRM TIHHGEGSVI YAAPGPAGYA DIGGHVTEDP PRQL                        224
//

If you have problems or comments...

PBIL Back to PBIL home page