(data stored in ACNUC7421 zone)

EMBL: CP002299.PE150

CP002299.PE150       Location/Qualifiers
FT   CDS             195041..196039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0150"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gob:Gobs_0441 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78238"
FT                   /db_xref="GOA:E3J4R9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R9"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78238.1"
FT                   /translation="MSTVSVVVCSHLVARFTLLVAALESLRAQTRAPDQVVVVVDGDDE
FT                   LLKKLHDRGGDELVLSTGGRTGLSNARNTGLRAVTTDFVAFLDDDATAEPAWLEALMAA
FT                   VSSSANVLGVGGRTLPAWESKQPAWFPDELLWTVGCSHLGLPASCQPVRNVFGGCALFR
FT                   RPLFDEVGGFDDRLGRKAKGAAGCEETEFCIRAQRLHAGGTFLYEPAAVIHHRVPLGRS
FT                   SPRYVLRRCWEEGRSKALLRVITRGVGQPERAARRKSSLGPERDFLLRVLPSGVFGGLR
FT                   AAVRGQPAAAGRALLLLVGSATTVVSFVGAALLSTRRGGATVPEPAGLAQP"
     MSTVSVVVCS HLVARFTLLV AALESLRAQT RAPDQVVVVV DGDDELLKKL HDRGGDELVL        60
     STGGRTGLSN ARNTGLRAVT TDFVAFLDDD ATAEPAWLEA LMAAVSSSAN VLGVGGRTLP       120
     AWESKQPAWF PDELLWTVGC SHLGLPASCQ PVRNVFGGCA LFRRPLFDEV GGFDDRLGRK       180
     AKGAAGCEET EFCIRAQRLH AGGTFLYEPA AVIHHRVPLG RSSPRYVLRR CWEEGRSKAL       240
     LRVITRGVGQ PERAARRKSS LGPERDFLLR VLPSGVFGGL RAAVRGQPAA AGRALLLLVG       300
     SATTVVSFVG AALLSTRRGG ATVPEPAGLA QP                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page