(data stored in ACNUC7421 zone)

EMBL: CP002299.PE151

CP002299.PE151       Location/Qualifiers
FT   CDS             196104..196877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0151"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   fal:FRAAL1353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78239"
FT                   /db_xref="GOA:E3J4S0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S0"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADP78239.1"
FT                   /translation="MYHSVGQGASSAFRRWQVDPGLFAEQLGALVDAGYRLVGLSAALD
FT                   EPDERTVAVTFDDGFVDFLGATELLVAAGCGATLYVPTAHVARRARWMAGYREAELRIM
FT                   DWSELSEVAAAGIEVGSHGHAHAELDLMPAHLMRADILLSRRMLADRLGRPVRSFCYPF
FT                   GYHTRTVRSAVASAGFASACEVGYGLHPRAGDAFAVRRLIVTGDTRPADMRRLVTEGQD
FT                   SPVMQLRRRTRTPWRIYRAAHHIATRSHAEAEPGD"
     MYHSVGQGAS SAFRRWQVDP GLFAEQLGAL VDAGYRLVGL SAALDEPDER TVAVTFDDGF        60
     VDFLGATELL VAAGCGATLY VPTAHVARRA RWMAGYREAE LRIMDWSELS EVAAAGIEVG       120
     SHGHAHAELD LMPAHLMRAD ILLSRRMLAD RLGRPVRSFC YPFGYHTRTV RSAVASAGFA       180
     SACEVGYGLH PRAGDAFAVR RLIVTGDTRP ADMRRLVTEG QDSPVMQLRR RTRTPWRIYR       240
     AAHHIATRSH AEAEPGD                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page