(data stored in ACNUC7421 zone)

EMBL: CP002299.PE155

CP002299.PE155       Location/Qualifiers
FT   CDS             203447..204652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0155"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78243"
FT                   /db_xref="GOA:E3J4S4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78243.1"
FT                   /translation="MPGDIGYYLVYLPLGTIGLVRWLCWLARRIPAALYRPVGGDLRLP
FT                   LTVVVPVYQEDPEVFTRALTSWLANDVDEVILVIDATDTACRRIAADFPVTVLVTEVPG
FT                   KRDALRRGWEAASTELVALVDSDTIWADDVAAEVCKPFADPAVGGVATRQNVYNPRGFL
FT                   QRITDLFLDCRYFDENAAQSVMGRALSCLSGRTAIYRRALLVEVSHEFMTEKFLGVQCM
FT                   SGDDKRLTTLLLERGHATVLQRSARVWSSFPDTWRLFCRQRLRWARNTWRSDLRALSRR
FT                   WVWRRPFLAFSMVEKAVSGFTLLVSPTFMTLALLRHHWFFCGCLACWWWLSRAAKALPH
FT                   LRRQPSSFFLIPGWILVSFAMSVIKIGALVTVRRQRWLTRQVAVENGVVVRTAGAAVEA
FT                   IS"
     MPGDIGYYLV YLPLGTIGLV RWLCWLARRI PAALYRPVGG DLRLPLTVVV PVYQEDPEVF        60
     TRALTSWLAN DVDEVILVID ATDTACRRIA ADFPVTVLVT EVPGKRDALR RGWEAASTEL       120
     VALVDSDTIW ADDVAAEVCK PFADPAVGGV ATRQNVYNPR GFLQRITDLF LDCRYFDENA       180
     AQSVMGRALS CLSGRTAIYR RALLVEVSHE FMTEKFLGVQ CMSGDDKRLT TLLLERGHAT       240
     VLQRSARVWS SFPDTWRLFC RQRLRWARNT WRSDLRALSR RWVWRRPFLA FSMVEKAVSG       300
     FTLLVSPTFM TLALLRHHWF FCGCLACWWW LSRAAKALPH LRRQPSSFFL IPGWILVSFA       360
     MSVIKIGALV TVRRQRWLTR QVAVENGVVV RTAGAAVEAI S                           401
//

If you have problems or comments...

PBIL Back to PBIL home page