(data stored in ACNUC7421 zone)

EMBL: CP002299.PE159

CP002299.PE159       Location/Qualifiers
FT   CDS             209688..210668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0159"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; KEGG:
FT                   afu:AF0596 UDP-glucose dehydrogenase (ugd-2); PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78247"
FT                   /db_xref="GOA:E3J4S8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S8"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADP78247.1"
FT                   /translation="MRIFIIGSGVVGTATGRGFIEAGHRVTFVDVSPQRVEDLTARGLD
FT                   ARARIDLATEEAAYIFLTLPTPNDGTRYDLTAFLEGTRAVGRALREADAVHTVVVRSTV
FT                   TPGTTEGLVGPVLERESGLRQDEGFLLASNPEFLRAASAVADFRWPRMTVVGARNRRVR
FT                   ERLVELFTPFGGELRVFAEPMTAEFIKCAHNIFNATKISFWNEMHAVAQRAGLDLAEIA
FT                   ETVARSAEASFNPTYGIRGGAPYGGACLPKDTKAFLGFADTLDIDMPLLRAVVEVNDRL
FT                   VGSPSAVPVPAALVPAAMTGPPRIEIPEQPTGDRVPARAAESPVR"
     MRIFIIGSGV VGTATGRGFI EAGHRVTFVD VSPQRVEDLT ARGLDARARI DLATEEAAYI        60
     FLTLPTPNDG TRYDLTAFLE GTRAVGRALR EADAVHTVVV RSTVTPGTTE GLVGPVLERE       120
     SGLRQDEGFL LASNPEFLRA ASAVADFRWP RMTVVGARNR RVRERLVELF TPFGGELRVF       180
     AEPMTAEFIK CAHNIFNATK ISFWNEMHAV AQRAGLDLAE IAETVARSAE ASFNPTYGIR       240
     GGAPYGGACL PKDTKAFLGF ADTLDIDMPL LRAVVEVNDR LVGSPSAVPV PAALVPAAMT       300
     GPPRIEIPEQ PTGDRVPARA AESPVR                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page