(data stored in ACNUC7421 zone)

EMBL: CP002299.PE163

CP002299.PE163       Location/Qualifiers
FT   CDS             215844..216887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cnb:CNBG3070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78251"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T2"
FT                   /inference="similar to AA sequence:KEGG:CNBG3070"
FT                   /protein_id="ADP78251.1"
FT                   /translation="MTGPTRPAGRGYQARTRGSRRDRMVRGVTLVVLPALAGLAACSGG
FT                   RPQGGHGGSAPTPAPTASRSGPAAADEPTAPTSPLARFFGDDLVMRSRGSFNLDKVRLV
FT                   SSGDRCVPTYLRVRYPAGSASQLSVRNEDAPTGGAQAYLLLKSGPTDILHLSYRVRFPA
FT                   GFQFNKGGKLPGLFGGDHVAGGNIPDGSNGLSTRYMWRAGGAGEVYAYLPSSQVHGTNI
FT                   GTGSWSFPPGQWVTMQQRVRLNTPGQADGSITVWMDGRQALRVDNLLFRDSGTLQIDGL
FT                   FFSTFFGGGDTTWASPTDQYADFADFQVSPNYINDTMPAGCAPPGPTITPSLWPSSETS
FT                   DGSGPDQ"
     MTGPTRPAGR GYQARTRGSR RDRMVRGVTL VVLPALAGLA ACSGGRPQGG HGGSAPTPAP        60
     TASRSGPAAA DEPTAPTSPL ARFFGDDLVM RSRGSFNLDK VRLVSSGDRC VPTYLRVRYP       120
     AGSASQLSVR NEDAPTGGAQ AYLLLKSGPT DILHLSYRVR FPAGFQFNKG GKLPGLFGGD       180
     HVAGGNIPDG SNGLSTRYMW RAGGAGEVYA YLPSSQVHGT NIGTGSWSFP PGQWVTMQQR       240
     VRLNTPGQAD GSITVWMDGR QALRVDNLLF RDSGTLQIDG LFFSTFFGGG DTTWASPTDQ       300
     YADFADFQVS PNYINDTMPA GCAPPGPTIT PSLWPSSETS DGSGPDQ                     347
//

If you have problems or comments...

PBIL Back to PBIL home page