(data stored in ACNUC7421 zone)

EMBL: CP002299.PE165

CP002299.PE165       Location/Qualifiers
FT   CDS             complement(218609..219220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0165"
FT                   /product="protein of unknown function DUF218"
FT                   /note="KEGG: fal:FRAAL6288 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78253"
FT                   /db_xref="GOA:E3J4T4"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T4"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADP78253.1"
FT                   /translation="MSRSLVRLPRQFRPVVPAPIGPAVADGPVRRRFPRRAILRTAAAL
FT                   VVLFILFIGATLAIIVFPPTDRPARANAILMLGGAGDRRDRALELARAGYAPVLALSTP
FT                   NARHCPTVPNVKVICFRPDPFTTQGEAREAGRLAARYGWTRMIFVTDRSQNVRARLRID
FT                   RCYAGKKIMVSVDPPFRDWPYLIAYQWSAMFKALIWQRSC"
     MSRSLVRLPR QFRPVVPAPI GPAVADGPVR RRFPRRAILR TAAALVVLFI LFIGATLAII        60
     VFPPTDRPAR ANAILMLGGA GDRRDRALEL ARAGYAPVLA LSTPNARHCP TVPNVKVICF       120
     RPDPFTTQGE AREAGRLAAR YGWTRMIFVT DRSQNVRARL RIDRCYAGKK IMVSVDPPFR       180
     DWPYLIAYQW SAMFKALIWQ RSC                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page