(data stored in ACNUC7421 zone)

EMBL: CP002299.PE166

CP002299.PE166       Location/Qualifiers
FT   CDS             complement(219571..220494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0166"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   fal:FRAAL6675 putative secreted lipase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78254"
FT                   /db_xref="GOA:E3J4T5"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T5"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADP78254.1"
FT                   /translation="MQLRAPASARARRLVALGVVSLFVTIATLLTACQPPTVANAATGS
FT                   STRKPLTRDQPLTIVALGDSYSSGEGNAPFDTDAATCHRSASAWPRLLGQQLTGSTVKL
FT                   LACSGAKTYSLTSAFHGQSAQITALKSLLSAGVHPDVVTITIGGNDAGFGPTIASCVVW
FT                   RCFWTGHDNNSVQFVENQLPGLLQTAYQGVKAAAPNARILVVGYPDIFPSRSDNTCKWM
FT                   DSTERVQLVGLNDDLDRVAKRAAGKAGVEFVSTANTLNGHRLCTTDSWLYPVELLGAGT
FT                   TASAHPNAQGEQAIADAVYGYLFKGK"
     MQLRAPASAR ARRLVALGVV SLFVTIATLL TACQPPTVAN AATGSSTRKP LTRDQPLTIV        60
     ALGDSYSSGE GNAPFDTDAA TCHRSASAWP RLLGQQLTGS TVKLLACSGA KTYSLTSAFH       120
     GQSAQITALK SLLSAGVHPD VVTITIGGND AGFGPTIASC VVWRCFWTGH DNNSVQFVEN       180
     QLPGLLQTAY QGVKAAAPNA RILVVGYPDI FPSRSDNTCK WMDSTERVQL VGLNDDLDRV       240
     AKRAAGKAGV EFVSTANTLN GHRLCTTDSW LYPVELLGAG TTASAHPNAQ GEQAIADAVY       300
     GYLFKGK                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page