(data stored in ACNUC7421 zone)

EMBL: CP002299.PE168

CP002299.PE168       Location/Qualifiers
FT   CDS             complement(222657..224720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0168"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; KEGG: fal:FRAAL2105 putative
FT                   undecaprenyl-phosphate glycosyl-1-phosphate transferase;
FT                   PFAM: sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78256"
FT                   /db_xref="GOA:E3J4T7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T7"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADP78256.1"
FT                   /translation="MDENAVDHDKTDDTVTDGEPTVRVPRQRLSLSAAGQDDANRRDDA
FT                   ATVNVPAISTRAGARRAQPRVPAQPTGEPAADEAAGDAVTDPNALTGPILLPLPQGGLE
FT                   SVGLREPALPSDGLVDVVPADLPHVDEPLDDDLADDTADDAADDTWATTDGPGPPDAAT
FT                   SDDAGDLDDGADPLPRLRSSRPASSPRRREATALDGWSLREPYRAQVSWERKYTRLVIG
FT                   ADLAAGALAAGVAYLLRFGDVGVFDLAPTQLRPYLLVSAVFPVVWVLTMALNRTYEGRF
FT                   LGGGSEEFRRVVNAAVRLIAVVAVGSYTTKFEVARAYVLIVFPLATLLTLISRVAARWL
FT                   LHRMRRVGRCQHRVLVVGAGESAASLVRLARRDPSAGWNVVGVCLDRAPGRHSHDGLAR
FT                   AGFDLLGIPIVGTSEALPEAIRLTDATTVAISPQLDGERLRRALWALEGSNVDVLVSSA
FT                   VTDVTGPRIHLRPVAGLPLLHIEEPELTGARRLMKGLLDRGVALIALTLLAPLLLGLAL
FT                   AVRLTSRGPAIFRQTRVGRGGREFTMFKFRSMFIDAEARLAELAAQNEREDEFMFKIRN
FT                   DPRITRAGGFLRKWSLDEVPQLFNVLNGSMSLVGPRPPLPREVAKYADDVHRRLMVKPG
FT                   LTGLWQVSGRSDLPTDEAVRLDLRYVENWSLAMDLMILWKTVFAVIKREGAY"
     MDENAVDHDK TDDTVTDGEP TVRVPRQRLS LSAAGQDDAN RRDDAATVNV PAISTRAGAR        60
     RAQPRVPAQP TGEPAADEAA GDAVTDPNAL TGPILLPLPQ GGLESVGLRE PALPSDGLVD       120
     VVPADLPHVD EPLDDDLADD TADDAADDTW ATTDGPGPPD AATSDDAGDL DDGADPLPRL       180
     RSSRPASSPR RREATALDGW SLREPYRAQV SWERKYTRLV IGADLAAGAL AAGVAYLLRF       240
     GDVGVFDLAP TQLRPYLLVS AVFPVVWVLT MALNRTYEGR FLGGGSEEFR RVVNAAVRLI       300
     AVVAVGSYTT KFEVARAYVL IVFPLATLLT LISRVAARWL LHRMRRVGRC QHRVLVVGAG       360
     ESAASLVRLA RRDPSAGWNV VGVCLDRAPG RHSHDGLARA GFDLLGIPIV GTSEALPEAI       420
     RLTDATTVAI SPQLDGERLR RALWALEGSN VDVLVSSAVT DVTGPRIHLR PVAGLPLLHI       480
     EEPELTGARR LMKGLLDRGV ALIALTLLAP LLLGLALAVR LTSRGPAIFR QTRVGRGGRE       540
     FTMFKFRSMF IDAEARLAEL AAQNEREDEF MFKIRNDPRI TRAGGFLRKW SLDEVPQLFN       600
     VLNGSMSLVG PRPPLPREVA KYADDVHRRL MVKPGLTGLW QVSGRSDLPT DEAVRLDLRY       660
     VENWSLAMDL MILWKTVFAV IKREGAY                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page