(data stored in ACNUC7421 zone)

EMBL: CP002299.PE169

CP002299.PE169       Location/Qualifiers
FT   CDS             complement(225426..226178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0169"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   KEGG: fal:FRAAL6674 pantothenate kinase; PFAM: Bvg
FT                   accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78257"
FT                   /db_xref="GOA:E3J4T8"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T8"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADP78257.1"
FT                   /translation="MLLTIDIGNTNTVLGVFEGETLADSWRVRTQANATSDELAFLYRG
FT                   LIGEYRIDGVSVCSTVPAALREIRRMAGRLFKHVPVVVVEPGTRTGVPILIDNPKEAGA
FT                   DRIMNTLAAHHLHGGPTIVVDFGTSTNIDVVSARGEFLGGALAPGIEIALDALASRAAQ
FT                   LRKVELVPPRSVIGKGTVEALQSGMIYGVAGQVDGLVRRIRTELGTEATTVATGGLAPL
FT                   VLKESETLQVHEPHLTLIGLRLVFAKNA"
     MLLTIDIGNT NTVLGVFEGE TLADSWRVRT QANATSDELA FLYRGLIGEY RIDGVSVCST        60
     VPAALREIRR MAGRLFKHVP VVVVEPGTRT GVPILIDNPK EAGADRIMNT LAAHHLHGGP       120
     TIVVDFGTST NIDVVSARGE FLGGALAPGI EIALDALASR AAQLRKVELV PPRSVIGKGT       180
     VEALQSGMIY GVAGQVDGLV RRIRTELGTE ATTVATGGLA PLVLKESETL QVHEPHLTLI       240
     GLRLVFAKNA                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page