(data stored in ACNUC7421 zone)

EMBL: CP002299.PE174

CP002299.PE174       Location/Qualifiers
FT   CDS             232843..235824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssc:100049648 basic proline-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78262"
FT                   /db_xref="GOA:E3J4U3"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U3"
FT                   /inference="similar to AA sequence:KEGG:100049648"
FT                   /protein_id="ADP78262.1"
FT                   /translation="MSDAGSGPKAGPETDEAKAATRGSSETPGGRGHSPSPAEPEASRG
FT                   VSTRRRTEPGRGETPAEGSARVDEGSQTIKLPPGQNPAPSPPSVYSRAAVRVAVDETTT
FT                   TPRPGGGPREPTAPPAPPSVYTSTPPRGARRPEAPGERTTRVERPRPERRDTVDPAAPP
FT                   ASGSSPAGERTTRVDRSRVERRDTVDPAAPRTPGRGAGVPAAGSAAPSAEHTARVDRSR
FT                   VTRRDTVDDPAAVTSRGAGPPKAPPPDSTELLDRRKIAGATSGDRPSAAAAGRAATDRA
FT                   STGGAPTDRAATDRAAAGRVATDRASTDRASTDRAAGGRAPAERAVTQATRPVGHRAAT
FT                   PEPNPAETTMRISRRDLPGGRQGRMALLADPSMAETTIHMSRSAMPPGSLLFQTGPVPI
FT                   PLREELTAAAPTPPAEESESQAPSLLRRVPAGLIDSSLSSMGSFLMGLFAQYFLPAATL
FT                   GTYGLFYQAFIAVSVIPTGIVFSPVEYTSAGVAARRRRVQLLPQSLQLGMAPAILAALL
FT                   VPFVLIIPSDGQSVGSRVGFAVTAALVAVASPMQDHIRRMLHQAGMSWTAAATSLVQVV
FT                   TVAVGLVVAKVAHVPPAWVPFGALAVANLVSGAFALWKGKPGNRAPMLLKLRSLFALGG
FT                   WIVVGNVLSASGPFINFALLTALANSTDVGNGEGSRVLAQPVTVLVIGLLAVLNPEIME
FT                   AAHNRAVRKLIKICLLFWGMVAVAILAWALLVGFEWPFNPLPRFQKPAYEVHGLLPWTI
FT                   ITEGAGYSVLVLITIANAAGRARAASVASLVAVVVSGVAVAATAKHFGPFALIWGAGAT
FT                   VVAMYAVNGAVVLNEFRRPARPAAAAPSAAAEPPVRPASAPPSRPMAGPARPVPGQARP
FT                   VPGSARPGPASGRPAPASGRPVPGPGGPAMPGQGRPAAPGPVPARLPPAGTRPDDAPTR
FT                   RGPLPAPPPAAPPRPPAPAPAPAPQPQPQPVAEQPAPAPRGGRGRHSRGGSGLRRPDVF
FT                   DRKR"
     MSDAGSGPKA GPETDEAKAA TRGSSETPGG RGHSPSPAEP EASRGVSTRR RTEPGRGETP        60
     AEGSARVDEG SQTIKLPPGQ NPAPSPPSVY SRAAVRVAVD ETTTTPRPGG GPREPTAPPA       120
     PPSVYTSTPP RGARRPEAPG ERTTRVERPR PERRDTVDPA APPASGSSPA GERTTRVDRS       180
     RVERRDTVDP AAPRTPGRGA GVPAAGSAAP SAEHTARVDR SRVTRRDTVD DPAAVTSRGA       240
     GPPKAPPPDS TELLDRRKIA GATSGDRPSA AAAGRAATDR ASTGGAPTDR AATDRAAAGR       300
     VATDRASTDR ASTDRAAGGR APAERAVTQA TRPVGHRAAT PEPNPAETTM RISRRDLPGG       360
     RQGRMALLAD PSMAETTIHM SRSAMPPGSL LFQTGPVPIP LREELTAAAP TPPAEESESQ       420
     APSLLRRVPA GLIDSSLSSM GSFLMGLFAQ YFLPAATLGT YGLFYQAFIA VSVIPTGIVF       480
     SPVEYTSAGV AARRRRVQLL PQSLQLGMAP AILAALLVPF VLIIPSDGQS VGSRVGFAVT       540
     AALVAVASPM QDHIRRMLHQ AGMSWTAAAT SLVQVVTVAV GLVVAKVAHV PPAWVPFGAL       600
     AVANLVSGAF ALWKGKPGNR APMLLKLRSL FALGGWIVVG NVLSASGPFI NFALLTALAN       660
     STDVGNGEGS RVLAQPVTVL VIGLLAVLNP EIMEAAHNRA VRKLIKICLL FWGMVAVAIL       720
     AWALLVGFEW PFNPLPRFQK PAYEVHGLLP WTIITEGAGY SVLVLITIAN AAGRARAASV       780
     ASLVAVVVSG VAVAATAKHF GPFALIWGAG ATVVAMYAVN GAVVLNEFRR PARPAAAAPS       840
     AAAEPPVRPA SAPPSRPMAG PARPVPGQAR PVPGSARPGP ASGRPAPASG RPVPGPGGPA       900
     MPGQGRPAAP GPVPARLPPA GTRPDDAPTR RGPLPAPPPA APPRPPAPAP APAPQPQPQP       960
     VAEQPAPAPR GGRGRHSRGG SGLRRPDVFD RKR                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page