(data stored in ACNUC7421 zone)

EMBL: CP002299.PE175

CP002299.PE175       Location/Qualifiers
FT   CDS             236069..237046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0175"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rce:RC1_3994 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78263"
FT                   /db_xref="GOA:E3J4U4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78263.1"
FT                   /translation="MTESRVPEVSIGIPVYNGADYLGTAIESHLAQTFGDFELVISDNA
FT                   STDGTEELCRGYAKEDSRVRYVRQAENIGANANFNEVVRLSRAPYYRWAADDDTLSPEY
FT                   LEKTYGLLSKDDDAVLCHSFTTYIDEDGKELRPAGDGVGFVDDKGTYVDGPDPNIATRQ
FT                   LRSPYPHVRFRDVLLHTKWCFEIFGLMRREVLLSTAMQQKFYGTDRVILAEMALLGTWR
FT                   VVEEPLWQRRSHSGASNNMSVWQKAKWSNPDAKKSLLPPVSNMIRGYIDAIDRHTFPPV
FT                   EKAQCYAAVGVLAVQPDKFRKLLVPGPHNYFGIGNKQSNAAHRL"
     MTESRVPEVS IGIPVYNGAD YLGTAIESHL AQTFGDFELV ISDNASTDGT EELCRGYAKE        60
     DSRVRYVRQA ENIGANANFN EVVRLSRAPY YRWAADDDTL SPEYLEKTYG LLSKDDDAVL       120
     CHSFTTYIDE DGKELRPAGD GVGFVDDKGT YVDGPDPNIA TRQLRSPYPH VRFRDVLLHT       180
     KWCFEIFGLM RREVLLSTAM QQKFYGTDRV ILAEMALLGT WRVVEEPLWQ RRSHSGASNN       240
     MSVWQKAKWS NPDAKKSLLP PVSNMIRGYI DAIDRHTFPP VEKAQCYAAV GVLAVQPDKF       300
     RKLLVPGPHN YFGIGNKQSN AAHRL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page