(data stored in ACNUC7421 zone)

EMBL: CP002299.PE178

CP002299.PE178       Location/Qualifiers
FT   CDS             240418..242109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0178"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: dba:Dbac_1703
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78266"
FT                   /db_xref="GOA:E3J4U7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U7"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADP78266.1"
FT                   /translation="MTAPAAELSRPAGGLGGRAEIGPPARPGMWMGRRWRPAPRPAAMR
FT                   GSVNSAVRRLETPAAERAARRMTMFGLIVTFGMVLGGRGFAYLGIAPINLYISEITIIT
FT                   MVIYSPTRAYITGLLRQTGRAGRLHLLAVAMVVFFSYGVIETVRGLFDGGSSTTLLKSL
FT                   QLYYYPILLSFGMWMGARDPKIFSKLVWALAWGNATYGILYAIVLNKLQITVPGNPGAP
FT                   LFDLGLTNAAMAILGLIVYHRRSKWLIPLILLNVAVLFGHQIRAEWLALIVSLVIYCVL
FT                   TRQYRRLVAGLGVVLVFATIITIINVKIPGPSDRGGAVRPTDVIGRAVGSVDPELASQF
FT                   TSAERVQGANGTAQFRQEWWNGIWHSATSDPTFLLFGHGYGFNLQTLAPPGNVDTTVRS
FT                   PHNIIFYSIGYTGFVGVALMALLFYAIARQLWTVFKRTGNPVGLALMALMVTASQFEPF
FT                   LESPFGAAACYLTLGMCLAPLMRLGGGDGRRLPARLERALAGMAHDRPALDLEPAPIPA
FT                   QRRYASRGGPVTSTDLIPEPGSSGSEGPPLRRPAALSAGAPRPGRR"
     MTAPAAELSR PAGGLGGRAE IGPPARPGMW MGRRWRPAPR PAAMRGSVNS AVRRLETPAA        60
     ERAARRMTMF GLIVTFGMVL GGRGFAYLGI APINLYISEI TIITMVIYSP TRAYITGLLR       120
     QTGRAGRLHL LAVAMVVFFS YGVIETVRGL FDGGSSTTLL KSLQLYYYPI LLSFGMWMGA       180
     RDPKIFSKLV WALAWGNATY GILYAIVLNK LQITVPGNPG APLFDLGLTN AAMAILGLIV       240
     YHRRSKWLIP LILLNVAVLF GHQIRAEWLA LIVSLVIYCV LTRQYRRLVA GLGVVLVFAT       300
     IITIINVKIP GPSDRGGAVR PTDVIGRAVG SVDPELASQF TSAERVQGAN GTAQFRQEWW       360
     NGIWHSATSD PTFLLFGHGY GFNLQTLAPP GNVDTTVRSP HNIIFYSIGY TGFVGVALMA       420
     LLFYAIARQL WTVFKRTGNP VGLALMALMV TASQFEPFLE SPFGAAACYL TLGMCLAPLM       480
     RLGGGDGRRL PARLERALAG MAHDRPALDL EPAPIPAQRR YASRGGPVTS TDLIPEPGSS       540
     GSEGPPLRRP AALSAGAPRP GRR                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page