(data stored in ACNUC7421 zone)

EMBL: CP002299.PE182

CP002299.PE182       Location/Qualifiers
FT   CDS             247351..248130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0182"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /note="KEGG: rca:Rcas_3094 glucose-1-phosphate
FT                   cytidylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   cytidylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78270"
FT                   /db_xref="GOA:E3J4V1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V1"
FT                   /inference="protein motif:TFAM:TIGR02623"
FT                   /protein_id="ADP78270.1"
FT                   /translation="MKIGILAGGLGTRLAEETAIKPKPMVEIGNQPIMWHIMKYYAHFH
FT                   LTDFTVALGYRGEYIKRWLVDYASLAANVSVSLRDGKVQWHEPETEREDWNVSLVETGL
FT                   ETNTGGRIKRLQPWIGTEGTFMLTWGDGVADVDLDALLAFHKSHGKLATLTAVRPPARF
FT                   GHIEMDGDRITEFSEKPQTGEGWINGAFFVLEPEIFDYIEGDSTQFEKEPLEELAKDGQ
FT                   LMAYKHSGFWQCMDTIRDRKLLQTLWDSGSAPWKVWD"
     MKIGILAGGL GTRLAEETAI KPKPMVEIGN QPIMWHIMKY YAHFHLTDFT VALGYRGEYI        60
     KRWLVDYASL AANVSVSLRD GKVQWHEPET EREDWNVSLV ETGLETNTGG RIKRLQPWIG       120
     TEGTFMLTWG DGVADVDLDA LLAFHKSHGK LATLTAVRPP ARFGHIEMDG DRITEFSEKP       180
     QTGEGWINGA FFVLEPEIFD YIEGDSTQFE KEPLEELAKD GQLMAYKHSG FWQCMDTIRD       240
     RKLLQTLWDS GSAPWKVWD                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page