(data stored in ACNUC7421 zone)

EMBL: CP002299.PE185

CP002299.PE185       Location/Qualifiers
FT   CDS             250398..251585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0185"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: C-methyltransferase; Methyltransferase type
FT                   11; KEGG: rca:Rcas_3091 C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78273"
FT                   /db_xref="GOA:E3J4V4"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V4"
FT                   /inference="protein motif:PFAM:PF08484"
FT                   /protein_id="ADP78273.1"
FT                   /translation="MTSIDRCPACGGANLTPFYAKDRVASHSCLLMDSEEEALAFPKGD
FT                   LRISFCDDCAFVFNTDYDGHLAAYSEKYEETQAFSAFFREFARDLAKRWVDKYDLHGKS
FT                   VLEIGCGKGEFLVNMIEQGAGTGIGIDPGVHPERIAPELEGKLTWIADYYSPSYNHLKA
FT                   DAVVCRHTLEHISPVGDFMRNIREAIGDQPDTIVLFELPDVLRILEDAAYWDVYYEHCT
FT                   YFSAGSLARLFRATGFEVLEVTREYDDQYLVIEARPSTVPAPGEPLEIEDDIARLAAAL
FT                   APFEQKVNSSLDNWADEIRAVRARGGRVAIWGSGSKGVSFFAGLGEASKLVDYAVDINP
FT                   YKHGKYMAGSGHLIVGPERLVEDKPELVIVMNPIYLGEIGDELKKLGVTTELKEV"
     MTSIDRCPAC GGANLTPFYA KDRVASHSCL LMDSEEEALA FPKGDLRISF CDDCAFVFNT        60
     DYDGHLAAYS EKYEETQAFS AFFREFARDL AKRWVDKYDL HGKSVLEIGC GKGEFLVNMI       120
     EQGAGTGIGI DPGVHPERIA PELEGKLTWI ADYYSPSYNH LKADAVVCRH TLEHISPVGD       180
     FMRNIREAIG DQPDTIVLFE LPDVLRILED AAYWDVYYEH CTYFSAGSLA RLFRATGFEV       240
     LEVTREYDDQ YLVIEARPST VPAPGEPLEI EDDIARLAAA LAPFEQKVNS SLDNWADEIR       300
     AVRARGGRVA IWGSGSKGVS FFAGLGEASK LVDYAVDINP YKHGKYMAGS GHLIVGPERL       360
     VEDKPELVIV MNPIYLGEIG DELKKLGVTT ELKEV                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page