(data stored in ACNUC7421 zone)

EMBL: CP002299.PE187

CP002299.PE187       Location/Qualifiers
FT   CDS             252132..252836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0187"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   fal:FRAAL6288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78275"
FT                   /db_xref="GOA:E3J4V6"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V6"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADP78275.1"
FT                   /translation="MTDRAAAAVGPQPTEPDESGEPPKPAVANGATAPAVEDGVAEPEP
FT                   APAVERAGIFRRFRRLRRGWLVVVGLVLVLVVGLLAATLRLFVFPKADSLTKADAIVMF
FT                   DGIGGRKYTTFWLAGHGYAPVVAVSTQDLTFCQKSLPTISGVQVFCFVPTPATTRGEAE
FT                   ATERLATEHGWKKVIVVTGRPQETRARIRVERCYQGQVEIKGVSPGRDNWPKTIVYEWG
FT                   ALIKALVFQRSC"
     MTDRAAAAVG PQPTEPDESG EPPKPAVANG ATAPAVEDGV AEPEPAPAVE RAGIFRRFRR        60
     LRRGWLVVVG LVLVLVVGLL AATLRLFVFP KADSLTKADA IVMFDGIGGR KYTTFWLAGH       120
     GYAPVVAVST QDLTFCQKSL PTISGVQVFC FVPTPATTRG EAEATERLAT EHGWKKVIVV       180
     TGRPQETRAR IRVERCYQGQ VEIKGVSPGR DNWPKTIVYE WGALIKALVF QRSC             234
//

If you have problems or comments...

PBIL Back to PBIL home page