(data stored in ACNUC7421 zone)

EMBL: CP002299.PE188

CP002299.PE188       Location/Qualifiers
FT   CDS             252887..253303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78276"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V7"
FT                   /inference="similar to AA sequence:KEGG:Krad_1844"
FT                   /protein_id="ADP78276.1"
FT                   /translation="MIPPQAGVIGESRPSLGRYPRMGIVDANDETIAELRHLVAVIDDT
FT                   IAQLERVRRRADEIEHRRVGGDLYRVIVEAEERPLIVESLSDVLDRLSSAAGRFRRAEA
FT                   TALAAEGWTHERIGQFFGVTRQRIGILLSRERVR"
     MIPPQAGVIG ESRPSLGRYP RMGIVDANDE TIAELRHLVA VIDDTIAQLE RVRRRADEIE        60
     HRRVGGDLYR VIVEAEERPL IVESLSDVLD RLSSAAGRFR RAEATALAAE GWTHERIGQF       120
     FGVTRQRIGI LLSRERVR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page