(data stored in ACNUC7421 zone)

EMBL: CP002299.PE189

CP002299.PE189       Location/Qualifiers
FT   CDS             253980..254927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78277"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V8"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6244"
FT                   /protein_id="ADP78277.1"
FT                   /translation="MTTVFTDSRMPDERRRERLYGGDLFVTSPSPAVQALVDFARELIE
FT                   DAFAPYDPVVAQHELPVEKFVEIFGPLKPKFIHHPKTKGLIADVVSGLGSDLDETYIDV
FT                   PRLRGATSDGYLTAGVGYAFPLHRDVWWSAPLAQINWWLPIYDFESESSMAFHPHYWSS
FT                   GISNGSEEFNYYVYNATGRAQAAQHVAKDTRKQPGPREPVQVDPQIRVVCPVGSVIGFS
FT                   AAQMHSTVPNTSGRTRFSIDFRTVNVADLRAGRSAPNVDTQCEGTSLRDFRRGSDQAAM
FT                   PAEVVAQYDSGEIPEGAVLVFDPNAAKAPADSMA"
     MTTVFTDSRM PDERRRERLY GGDLFVTSPS PAVQALVDFA RELIEDAFAP YDPVVAQHEL        60
     PVEKFVEIFG PLKPKFIHHP KTKGLIADVV SGLGSDLDET YIDVPRLRGA TSDGYLTAGV       120
     GYAFPLHRDV WWSAPLAQIN WWLPIYDFES ESSMAFHPHY WSSGISNGSE EFNYYVYNAT       180
     GRAQAAQHVA KDTRKQPGPR EPVQVDPQIR VVCPVGSVIG FSAAQMHSTV PNTSGRTRFS       240
     IDFRTVNVAD LRAGRSAPNV DTQCEGTSLR DFRRGSDQAA MPAEVVAQYD SGEIPEGAVL       300
     VFDPNAAKAP ADSMA                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page