(data stored in ACNUC7421 zone)

EMBL: CP002299.PE190

CP002299.PE190       Location/Qualifiers
FT   CDS             complement(254988..255899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0190"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   KEGG: fal:FRAAL6667
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   (SAICAR synthetase); PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78278"
FT                   /db_xref="GOA:E3J4V9"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V9"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADP78278.1"
FT                   /translation="MPLTHVEFAGLTHLGSGKVRELFAVGDDAVLLVASDRISAFDVIL
FT                   PTEIPDKGAVLTGLSLWWFDQLADLVPSHVISSNVDEYPDELQPYAEQLRGRSMLCHRL
FT                   DMALVECVARGYLTGSGLKDYVRTGAVSGHTLPEGLVDGSKLPHPIYTPSTKAPIGEHD
FT                   ENISRADAATRIGDDLAAELEKLTLQIFGRASDLAAERGILLADTKFEFGHDPAGVLRL
FT                   GDEVLTPDSSRFWPADSWAPGGAQPSYDKQFIRDYLVNTGWDKVSPAPELPDDIVFSTR
FT                   SRYVEAYERLTGISFADYLATS"
     MPLTHVEFAG LTHLGSGKVR ELFAVGDDAV LLVASDRISA FDVILPTEIP DKGAVLTGLS        60
     LWWFDQLADL VPSHVISSNV DEYPDELQPY AEQLRGRSML CHRLDMALVE CVARGYLTGS       120
     GLKDYVRTGA VSGHTLPEGL VDGSKLPHPI YTPSTKAPIG EHDENISRAD AATRIGDDLA       180
     AELEKLTLQI FGRASDLAAE RGILLADTKF EFGHDPAGVL RLGDEVLTPD SSRFWPADSW       240
     APGGAQPSYD KQFIRDYLVN TGWDKVSPAP ELPDDIVFST RSRYVEAYER LTGISFADYL       300
     ATS                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page