(data stored in ACNUC7421 zone)

EMBL: CP002299.PE192

CP002299.PE192       Location/Qualifiers
FT   CDS             258987..259856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0192"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="KEGG: fjo:Fjoh_0331 glucose-1-phosphate
FT                   thymidylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   thymidylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78280"
FT                   /db_xref="GOA:E3J4W1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W1"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ADP78280.1"
FT                   /translation="MKGIILAGGTGSRLYPITRAVSKQLMPVYDKPMIYYPLSTLMAAG
FT                   IREILVITTPADQAQFQRLLGDGSWLGCRFEYAVQAEPRGLAEAFIVGADFVGTDKVCL
FT                   ILGDNIFYGVGLGEQLKGYTDPVGGIVFAYHVSDPERYGVVEFDVDRRAVSIEEKPAKP
FT                   KSSFAVTGLYFYDNDVLEIAAQTQPSARGELEITAVNQAYLDRGRLGVHLLDRGTAWLD
FT                   TGTFNSLMQAAQFVQVIEERQGLKIGCVEEVAWREGFITDAQLAELLRPLSKSGYGTYL
FT                   EGLLNDDA"
     MKGIILAGGT GSRLYPITRA VSKQLMPVYD KPMIYYPLST LMAAGIREIL VITTPADQAQ        60
     FQRLLGDGSW LGCRFEYAVQ AEPRGLAEAF IVGADFVGTD KVCLILGDNI FYGVGLGEQL       120
     KGYTDPVGGI VFAYHVSDPE RYGVVEFDVD RRAVSIEEKP AKPKSSFAVT GLYFYDNDVL       180
     EIAAQTQPSA RGELEITAVN QAYLDRGRLG VHLLDRGTAW LDTGTFNSLM QAAQFVQVIE       240
     ERQGLKIGCV EEVAWREGFI TDAQLAELLR PLSKSGYGTY LEGLLNDDA                   289
//

If you have problems or comments...

PBIL Back to PBIL home page