(data stored in ACNUC7421 zone)

EMBL: CP002299.PE193

CP002299.PE193       Location/Qualifiers
FT   CDS             complement(259974..260804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0193"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="KEGG: mgi:Mflv_4758 WecB/TagA/CpsF family glycosyl
FT                   transferase; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78281"
FT                   /db_xref="GOA:E3J4W2"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W2"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADP78281.1"
FT                   /translation="MLEGGTEPRTATGTRRSAPVIREASCCGVRITACSFEDAVAAVIG
FT                   IPAKGDDEAPVTDAGSAIHLCNAYTLALADRDARLKSTLNTARFNFPDGWPVARLTRQR
FT                   TRLSEANSQKISGPDLFQAVLSAGRDHDVKHYFLGSTPEVLEALERSVRKAYPGVQIAG
FT                   VESPPFRELTPDERAEQRLRIIASGADLVWVGLGTPKQDWEVERLAAEIPAVFLAVGAA
FT                   FDFLAGLKPRAPRWMGDYGVEWIFRLVSEPKRLWKRYLVGNPQFILSVLRNRGH"
     MLEGGTEPRT ATGTRRSAPV IREASCCGVR ITACSFEDAV AAVIGIPAKG DDEAPVTDAG        60
     SAIHLCNAYT LALADRDARL KSTLNTARFN FPDGWPVARL TRQRTRLSEA NSQKISGPDL       120
     FQAVLSAGRD HDVKHYFLGS TPEVLEALER SVRKAYPGVQ IAGVESPPFR ELTPDERAEQ       180
     RLRIIASGAD LVWVGLGTPK QDWEVERLAA EIPAVFLAVG AAFDFLAGLK PRAPRWMGDY       240
     GVEWIFRLVS EPKRLWKRYL VGNPQFILSV LRNRGH                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page