(data stored in ACNUC7421 zone)

EMBL: CP002299.PE194

CP002299.PE194       Location/Qualifiers
FT   CDS             complement(261232..262245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0194"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="KEGG: sgr:SGR_1542 putative GDP-D-mannose
FT                   dehydratase; TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78282"
FT                   /db_xref="GOA:E3J4W3"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W3"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ADP78282.1"
FT                   /translation="MTKVALVTGVTGQDGSYLCELLLQKGYEVHGLVRRSSSFNTARID
FT                   HLYQDPHEDGRKLVLHHADLDDGLSLVNILRETGPSEVYNLGAQSHVRVSYDTPLYTAN
FT                   VTGVGALRILEAVRASNLDIRVYQASSSEMFGSTPPPQNEETPFHPRSPYACAKVYAYW
FT                   SAVNHRESYGMYVSNGILFNHESPRRGETFVTRKITRAVARIQAGLQKELYLGNLDATR
FT                   DWGYAPEYVNAMWMMLQAPEPDDYVVATGTTYSVREFCQVAFGHVGLNWEDYVRFDPKY
FT                   TRPAEVDALMGDASKIRTNLGWKPEVNFEELVQIMVDGDIQLLEDERSGRLVRVDR"
     MTKVALVTGV TGQDGSYLCE LLLQKGYEVH GLVRRSSSFN TARIDHLYQD PHEDGRKLVL        60
     HHADLDDGLS LVNILRETGP SEVYNLGAQS HVRVSYDTPL YTANVTGVGA LRILEAVRAS       120
     NLDIRVYQAS SSEMFGSTPP PQNEETPFHP RSPYACAKVY AYWSAVNHRE SYGMYVSNGI       180
     LFNHESPRRG ETFVTRKITR AVARIQAGLQ KELYLGNLDA TRDWGYAPEY VNAMWMMLQA       240
     PEPDDYVVAT GTTYSVREFC QVAFGHVGLN WEDYVRFDPK YTRPAEVDAL MGDASKIRTN       300
     LGWKPEVNFE ELVQIMVDGD IQLLEDERSG RLVRVDR                                337
//

If you have problems or comments...

PBIL Back to PBIL home page